Gene Information

Name : SN31241_15850 (SN31241_15850)
Accession : YP_008359502.1
Strain : Salmonella enterica USMARC-S3124.1
Genome accession: NC_021902
Putative virulence/resistance : Resistance
Product : Transcriptional activator ramA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1630012 - 1630353 bp
Length : 342 bp
Strand : +
Note : DNA-binding transcriptional regulator SoxS PRK10219; Transcriptional activator ramA of Bacteria UniRef RepID=RAMA_KLEPN

DNA sequence :
ATGACCATTTCCGCTCAGGTTATCGACACGATTGTCGAGTGGATTGATGATAATTTGAATCAGCCGTTACGTATTGATGA
TATTGCCCGTCATGCGGGGTATTCCAAGTGGCACCTGCAGCGCCTTTTTATGCAGTACAAAGGGGAGAGTCTGGGGCGCT
ACGTGCGTGAACGGAAGCTAAAACTGGCGGCGCGCGACCTGCTCGACACCGACCAGAAGGTGTATGATATTTGTCTCAAG
TATGGTTTTGATTCGCAGCAAACCTTTACGCGCATTTTTACCCGCACGTTCAACCTGCCGCCAGGCGCTTATCGTAAAGA
AAAGCATGGCCGTACGCATTGA

Protein sequence :
MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQYKGESLGRYVRERKLKLAARDLLDTDQKVYDICLK
YGFDSQQTFTRIFTRTFNLPPGAYRKEKHGRTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 5e-18 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-16 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-16 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP001138.1.gene612.p Protein 4e-43 99
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP001918.1.gene327.p Protein 1e-18 48
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP000647.1.gene4499. Protein 3e-18 48
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP001138.1.gene4488. Protein 2e-18 48
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP000647.1.gene1624. Protein 1e-17 46
SN31241_15850 YP_008359502.1 Transcriptional activator ramA NC_010558.1.6276025. Protein 6e-17 46
SN31241_15850 YP_008359502.1 Transcriptional activator ramA BAC0371 Protein 2e-17 45
SN31241_15850 YP_008359502.1 Transcriptional activator ramA NC_002695.1.914293.p Protein 2e-17 45
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP001918.1.gene2033. Protein 5e-18 45
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP000034.1.gene4505. Protein 4e-17 44
SN31241_15850 YP_008359502.1 Transcriptional activator ramA BAC0560 Protein 3e-18 43
SN31241_15850 YP_008359502.1 Transcriptional activator ramA NC_002695.1.917339.p Protein 3e-18 43
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP000034.1.gene1596. Protein 3e-18 43
SN31241_15850 YP_008359502.1 Transcriptional activator ramA CP001138.1.gene1637. Protein 4e-18 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SN31241_15850 YP_008359502.1 Transcriptional activator ramA VFG0585 Protein 1e-18 48
SN31241_15850 YP_008359502.1 Transcriptional activator ramA VFG1038 Protein 6e-17 46