Name : SN31241_6790 (SN31241_6790) Accession : YP_008358597.1 Strain : Salmonella enterica USMARC-S3124.1 Genome accession: NC_021902 Putative virulence/resistance : Virulence Product : Transcriptional regulator, AlpA Function : - COG functional category : - COG ID : - EC number : - Position : 698960 - 699166 bp Length : 207 bp Strand : + Note : Predicted transcriptional regulator COG3311; Transcriptional regulator, AlpA family of Enterobacteriaceae UniRef RepID=B4TEH7_SALHS DNA sequence : GTGTTACTGCGTGCCGACGATCCCCTGATCGACATGAACTACATCACCAGTTTCACCGGTATGACCGATAAATGGTTTTA CAAGCTGATCAGTGAAGGTCATTTCCCTAAACCCATCAAACTGGGGCGCAGCAGCCGCTGGTACAAAAGTGAAGTGGAGC AGTGGATGCAGCAGCGAATTGAGGAATCACGAGGAGCAGCAGCATGA Protein sequence : MLLRADDPLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWMQQRIEESRGAAA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-27 | 99 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 1e-27 | 99 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 8e-21 | 93 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 8e-21 | 93 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-17 | 70 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 1e-17 | 70 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-17 | 70 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 3e-17 | 70 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-17 | 70 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SN31241_6790 | YP_008358597.1 | Transcriptional regulator, AlpA | VFG1480 | Protein | 6e-28 | 99 |
SN31241_6790 | YP_008358597.1 | Transcriptional regulator, AlpA | VFG0651 | Protein | 8e-18 | 70 |