Gene Information

Name : B446_23020 (B446_23020)
Accession : YP_008388227.1
Strain : Streptomyces collinus Tu 365
Genome accession: NC_021985
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5287733 - 5288410 bp
Length : 678 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGCACGGCCCTGGAGCTCTCCCTGACGCGCCAGGGACACCG
GGTGGCCACCGCTGCCAGCGGTGAGGACGGTCTGAAACTGCTGCGCGAGCAGCGGCCGGACCTGATCGTGCTGGACGTGA
TGCTGCCCGGCATCGACGGGTTCGAGGTGTGCCGGCGCATCCGGCGCACCGACCAGCTGCCGATCATCCTGCTGACCGCG
CGGAGTGACGACATCGACGTGGTCGTCGGGCTGGAGTCCGGCGCCGACGACTACGTGGTCAAGCCCGTGCAGGGCCGGGT
GCTGGACGCCCGCATCCGGGCCGTGCTGCGGCGCGGGGAGCGCGAGTCGAGCGACTCCGCCACGTTCGGCAGCGTCGTGA
TCGACCGGTCGGCGATGACCGTGACCAAGAACGGCGAGGACCTGCAGCTCACCCCGACCGAGCTGCGGCTGCTGCTGGAG
CTGAGCCGGCGGCCCGGCCAGGCCCTGTCCCGGCAGCAGTTGCTGCGCCTGGTGTGGGAGCACGACTACCTGGGCGACTC
CCGCCTGGTGGACGCGTGTGTGCAGCGGCTGCGCGCCAAGGTGGAGGACGTGCCCTCGTCCCCGACCCTGATCCGTACCG
TCCGTGGTGTCGGCTACCGCCTGGACGTCCCTCAGTGA

Protein sequence :
MPSLLLIEDDDAIRTALELSLTRQGHRVATAASGEDGLKLLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIILLTA
RSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESSDSATFGSVVIDRSAMTVTKNGEDLQLTPTELRLLLE
LSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDVPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_23020 YP_008388227.1 two-component system response regulator AE000516.2.gene3505. Protein 8e-35 47
B446_23020 YP_008388227.1 two-component system response regulator NC_002952.2859905.p0 Protein 9e-38 44
B446_23020 YP_008388227.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_007622.3794472.p0 Protein 9e-38 44
B446_23020 YP_008388227.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-37 44
B446_23020 YP_008388227.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-39 43
B446_23020 YP_008388227.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-32 42
B446_23020 YP_008388227.1 two-component system response regulator BAC0197 Protein 4e-26 42
B446_23020 YP_008388227.1 two-component system response regulator AE015929.1.gene1106. Protein 4e-27 41
B446_23020 YP_008388227.1 two-component system response regulator BAC0125 Protein 1e-23 41
B446_23020 YP_008388227.1 two-component system response regulator NC_012469.1.7686381. Protein 8e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B446_23020 YP_008388227.1 two-component system response regulator VFG1389 Protein 9e-23 43
B446_23020 YP_008388227.1 two-component system response regulator VFG1390 Protein 3e-27 41
B446_23020 YP_008388227.1 two-component system response regulator VFG0596 Protein 1e-23 41