Gene Information

Name : emrE (BB2000_1550)
Accession : YP_008398101.1
Strain : Proteus mirabilis BB2000
Genome accession: NC_022000
Putative virulence/resistance : Resistance
Product : methyl viologen resistance protein (ethidium resistance protein)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1693624 - 1693956 bp
Length : 333 bp
Strand : -
Note : matching_protein_id: YP_002151245.1; matching_locus_tag: PMI1514

DNA sequence :
ATGAATGGATTAACTTACCTAATATTAGCCATTATATCTGAAGTTATTGCAACAACGGTGTTAAAAGCATCCGATGGCTT
TAGTCGATTATATCCATCTATTGTCGTCGTGGTGGGGTATTGTTTTTCTTTTTGGGCGCTATCTCAGGTTGTGAAAGTTA
TGCCACTGGGTATTGCATATGCAATTTGGAGCGGATTAGGTATTGTTTTAGTTTCTGTTGCGGCTGTTTTTGTCTATCAA
CAAAAACTCGATTTACCCGCCATCGTCGGTATGACATTAATTATTGCCGGCGTCTTAGTGATTAACTTACTTTCCAATAG
CACCTCACACTAA

Protein sequence :
MNGLTYLILAIISEVIATTVLKASDGFSRLYPSIVVVVGYCFSFWALSQVVKVMPLGIAYAIWSGLGIVLVSVAAVFVYQ
QKLDLPAIVGMTLIIAGVLVINLLSNSTSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-18 50
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 50
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 50
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-18 50
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 50
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 50
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-18 50
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-18 50
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-18 50
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-18 50
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 50
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-18 50
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-18 50
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-18 50
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-18 50
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-18 50
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-18 50
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-18 50
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-18 50
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-18 50
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 4e-17 44
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 5e-13 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) CP004022.1.gene1549. Protein 1e-44 100
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0377 Protein 1e-34 74
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) NC_002695.1.913273.p Protein 4e-24 59
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0150 Protein 4e-24 59
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) CP001138.1.gene1489. Protein 7e-24 55
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) NC_010410.6003348.p0 Protein 2e-18 54
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0002 Protein 2e-18 54
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0324 Protein 6e-21 53
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0322 Protein 2e-22 51
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0323 Protein 2e-18 50
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0326 Protein 3e-16 46
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0192 Protein 1e-14 43
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0477 Protein 4e-09 42
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) BAC0321 Protein 6e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) VFG1586 Protein 2e-17 44
emrE YP_008398101.1 methyl viologen resistance protein (ethidium resistance protein) VFG1587 Protein 2e-13 41