Gene Information

Name : N559_5157 (N559_5157)
Accession : YP_008414938.1
Strain :
Genome accession: NC_022078
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 29760 - 30215 bp
Length : 456 bp
Strand : -
Note : -

DNA sequence :
ATGCAAATTAATTTTGAGAATCTGACCATTGGCGTTTTTGCCAAGGCGGCCGGGGTCAATGTGGAGACCATCCGGTTCTA
CCAGCGCAAGGGCCTGCTGCCGGAGCCAGACAAGCCCTATGGCAGCATTCGCCGCTATGGCGAGGCGGATGTAACACGAG
TGCGGTTCGTGAAATCGGCCCAGCGGCTGGGCTTTAGCCTGGACGAAATCGCCGAGCTACTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGCGGCCTGGCCGAGCACAAGCTCAAGGATGTGCGCGAGAAGATGGCCGACTTGGCACGCATGGA
GGCCGTGCTGTCTGAACTGGTGTGCGCCTGCCATGCGCGGAAAGGGAACGTTTCCTGCCCGCTGATTGCGTCACTGCAAG
ACGGAACGAAGCTCGCTGCATCGGCGCGGGGGAGTCACGGGGTGACTACGCCTTAG

Protein sequence :
MQINFENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASGLAEHKLKDVREKMADLARMEAVLSELVCACHARKGNVSCPLIASLQDGTKLAASARGSHGVTTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-67 100
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-67 100
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-57 91
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-57 91
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 5e-57 91
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-57 91
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-56 90
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-56 90
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-48 78
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-45 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-27 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 6e-59 93
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 6e-59 93
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 1e-57 93
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 4e-59 90
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 8e-61 89
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 6e-59 89
N559_5157 YP_008414938.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 9e-56 86