Gene Information

Name : N559_2694 (N559_2694)
Accession : YP_008425650.1
Strain : Klebsiella pneumoniae JM45
Genome accession: NC_022082
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator MarA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2742825 - 2743202 bp
Length : 378 bp
Strand : +
Note : -

DNA sequence :
ATGATGTCCAGACGTAATAATGACGCCATCACTATCCATAGTATTTTGTCGTGGATCGAGGATAACCTGGAATCGCCCCT
GTCGCTGGAAAAAGTGTCTGAGCGCTCCGGTTACTCTAAGTGGCACCTGCAACGTATGTTTAAGAAAGAGACCGGCCATT
CCCTCGGCCAGTACATCCGCAGCCGCAAGCTGACGGAGATTGCGCAGAAGCTCAAGCAGAGTAATGAGCCAATCCTGTAC
CTGGCGGAACGCTATGGTTTCGAGTCGCAGCAGACCCTGACGCGAACGTTCAAGAACTATTTCGATGTTCCGCCCCACAA
GTATCGCATAACGAATGTACCTGGCGAATCCCGCTATCTACATCCGCTAAATAACTGA

Protein sequence :
MMSRRNNDAITIHSILSWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKQSNEPILY
LAERYGFESQQTLTRTFKNYFDVPPHKYRITNVPGESRYLHPLNN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-21 47
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-21 47
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP000647.1.gene1624. Protein 1e-55 100
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP001918.1.gene2033. Protein 8e-53 95
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA BAC0560 Protein 1e-52 93
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP001138.1.gene1637. Protein 1e-51 93
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA NC_002695.1.917339.p Protein 1e-52 93
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP000034.1.gene1596. Protein 2e-52 92
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA NC_010558.1.6276025. Protein 1e-21 47
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP001138.1.gene612.p Protein 2e-22 46
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA BAC0371 Protein 8e-20 43
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP000034.1.gene4505. Protein 1e-19 43
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA NC_002695.1.914293.p Protein 8e-20 43
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP001138.1.gene4488. Protein 7e-20 43
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP001918.1.gene327.p Protein 5e-20 43
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA CP000647.1.gene4499. Protein 1e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA VFG1038 Protein 1e-21 47
N559_2694 YP_008425650.1 DNA-binding transcriptional activator MarA VFG0585 Protein 6e-20 43