Gene Information

Name : O5Y_21610 (O5Y_21610)
Accession : YP_008454866.1
Strain : Rhodococcus erythropolis CCM2595
Genome accession: NC_022115
Putative virulence/resistance : Virulence
Product : two-component response regulator PrrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4748155 - 4748859 bp
Length : 705 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGACCGAGATACCGAAAATCCTCGTAGTCGACGACGACGCAGACGTCCTGACCTCACTCGAACGCGGATTGCGGCTCTC
GGGATTCACCGTACTGACGGCAGTGGACGGCGCCGACGCGCTCCGAGTGATCTCCGACAAGCGACCGGACGCGGTAGTCC
TCGACATCAACATGCCGGTGCTCGACGGCACCGGTGTGGTGACGGCGCTTCGTGCCGCCGGCAACGAAATCCCGATCTGC
GTGCTCAGCGCACGCAACTCGGTCGACGATCGCATCGCCGGGCTCGAATCCGGCGCAGACGACTACATGGTCAAACCGTT
TGTCCTCGCCGAACTGGTTGCCAGGATCCGCGCAATGCTCCGTCGCAGTAACACTCCGGCCGGCGATCACTCCGAGGGAA
CGAACACCCTGCGGGTCGGCAACCTCGACATCGACCTCTCCGGCCGCCGGGTTCGCGTCGACGGCAAGGAAGTACCGCTC
ACCAAACGCGAATTCGAGCTACTCGAAGTGCTCGCTCACAATTCCGGCATCGTGCTTACTCGCGAACGTCTCCTCGAACT
CGTGTGGGGCTACGACTTCGTGGCCGACACCAACGTCGTGGACGTCTTCATCGGCTACCTGCGTCGAAAGTTCGAATCCG
GCGGTTCACCTCGTCTGCTGCATACCGTTCGCGGCGTCGGGTTCGTGCTTCGGGAGAACCCGTGA

Protein sequence :
MTEIPKILVVDDDADVLTSLERGLRLSGFTVLTAVDGADALRVISDKRPDAVVLDINMPVLDGTGVVTALRAAGNEIPIC
VLSARNSVDDRIAGLESGADDYMVKPFVLAELVARIRAMLRRSNTPAGDHSEGTNTLRVGNLDIDLSGRRVRVDGKEVPL
TKREFELLEVLAHNSGIVLTRERLLELVWGYDFVADTNVVDVFIGYLRRKFESGGSPRLLHTVRGVGFVLRENP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O5Y_21610 YP_008454866.1 two-component response regulator PrrA BAC0083 Protein 2e-40 44
O5Y_21610 YP_008454866.1 two-component response regulator PrrA BAC0125 Protein 2e-37 43
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_012469.1.7685629. Protein 2e-35 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA BAC0347 Protein 2e-35 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA BAC0197 Protein 8e-35 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_002952.2859905.p0 Protein 7e-35 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_003923.1003749.p0 Protein 7e-35 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_002745.1124361.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_007622.3794472.p0 Protein 6e-35 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_009782.5559369.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_002951.3237708.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_002758.1121668.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_009641.5332272.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_013450.8614421.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA NC_007793.3914279.p0 Protein 1e-34 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA HE999704.1.gene2815. Protein 2e-36 41
O5Y_21610 YP_008454866.1 two-component response regulator PrrA AE000516.2.gene3505. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O5Y_21610 YP_008454866.1 two-component response regulator PrrA VFG1389 Protein 2e-75 72
O5Y_21610 YP_008454866.1 two-component response regulator PrrA VFG1390 Protein 1e-55 52
O5Y_21610 YP_008454866.1 two-component response regulator PrrA VFG1386 Protein 4e-48 46
O5Y_21610 YP_008454866.1 two-component response regulator PrrA VFG0596 Protein 6e-35 41