Gene Information

Name : O5Y_02835 (O5Y_02835)
Accession : YP_008451163.1
Strain : Rhodococcus erythropolis CCM2595
Genome accession: NC_022115
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 620893 - 621468 bp
Length : 576 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGGCGTCAGCTTGACCAAAGGCGGCAATGTCTCTCTCACGAAGGAGGCCCCGAACCTGACTGCAGTGGTCGTCGGCCT
GGGCTGGGACGCGCGTTCCACCACCGGAGCTGCTTTCGACCTCGACGCCAGCGCAATCGGCGCAGGCTCGAACAAGAAGG
TCCTCTCCGACCAGCACTTCATCTTCTTCAACAACCTCCGTTCGCCCGACGGCTCGATCGAGCACAAGGGTGACAACACG
GACGGCGAAGGCGAAGGCGACGACGAGCAGATCGACGTGAACCTCGCAGCGGTTCCCGCCGAGGTCGAGAGCGTTGTCTT
CCCCGTCTCGATCTACGACGCAGAAGCTCGCTCGCAGTCCTTCGGCCAGGTCCGCAACGCGTACATCCGCGTCGTCGACA
AGTCGAACGGCAACGAGCTCGCTCGTTACGACCTCTCCGAGGACGCTTCCACCGAGACCGCCATGGTCTTCGGTGAGCTG
TACCGCAACGGTGCAGAGTGGAAGTTCCGCGCAATCGGCCAGGGCTACGCGTCCGGCCTCGCGGGCATCGCGCGCGATTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLTKGGNVSLTKEAPNLTAVVVGLGWDARSTTGAAFDLDASAIGAGSNKKVLSDQHFIFFNNLRSPDGSIEHKGDNT
DGEGEGDDEQIDVNLAAVPAEVESVVFPVSIYDAEARSQSFGQVRNAYIRVVDKSNGNELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-56 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-56 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-56 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-53 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-53 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-54 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-26 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-22 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O5Y_02835 YP_008451163.1 tellurium resistance protein BAC0390 Protein 9e-56 62
O5Y_02835 YP_008451163.1 tellurium resistance protein BAC0389 Protein 8e-53 62
O5Y_02835 YP_008451163.1 tellurium resistance protein BAC0392 Protein 6e-22 42