Gene Information

Name : rpmE (N175_02610)
Accession : YP_008486986.1
Strain :
Genome accession: NC_022223
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 543944 - 544159 bp
Length : 216 bp
Strand : -
Note : RpmE; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster have the CXXC motif; RpmE is found in exponentially growing B

DNA sequence :
ATGAAAGCTGGTATCCATCCAGAGTACAAAGCAGTTAGCGCGACTTGTTCTTGCGGCAACTCTTTCGAGTTCAGCTCAAC
GCTAGGCAAAGATTCTATCCACCTAGACGTGTGTGACAAATGTCACCCATTCTACACTGGTAAGCAACGTATCGTTGATA
CTGGCGGCCGTGTAGATCGCTTCAACAAGCGTTTCGGTGCTCTTTCTAGCAAATAA

Protein sequence :
MKAGIHPEYKAVSATCSCGNSFEFSSTLGKDSIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 1e-08 42
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 1e-08 42