|
Name : rpmE (N175_02610) Accession : YP_008486986.1 Strain : Genome accession: NC_022223 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : - COG ID : - EC number : - Position : 543944 - 544159 bp Length : 216 bp Strand : - Note : RpmE; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster have the CXXC motif; RpmE is found in exponentially growing B DNA sequence : ATGAAAGCTGGTATCCATCCAGAGTACAAAGCAGTTAGCGCGACTTGTTCTTGCGGCAACTCTTTCGAGTTCAGCTCAAC GCTAGGCAAAGATTCTATCCACCTAGACGTGTGTGACAAATGTCACCCATTCTACACTGGTAAGCAACGTATCGTTGATA CTGGCGGCCGTGTAGATCGCTTCAACAAGCGTTTCGGTGCTCTTTCTAGCAAATAA Protein sequence : MKAGIHPEYKAVSATCSCGNSFEFSSTLGKDSIHLDVCDKCHPFYTGKQRIVDTGGRVDRFNKRFGALSSK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-08 | 42 |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-08 | 42 |
