Gene Information

Name : SAKOR_00018 (SAKOR_00018)
Accession : YP_008490202.1
Strain : Staphylococcus aureus CN1
Genome accession: NC_022226
Putative virulence/resistance : Virulence
Product : Two-component response regulator VicR/WalR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 24934 - 25641 bp
Length : 708 bp
Strand : +
Note : -

DNA sequence :
ATGCAAATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAACTTAAAAAAAGA
AGGATACGATGTGTACTGTGCATACGATGGTAACGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTAT
TAGATATCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATTATAATG
CTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAG
TACACGTGAATTAATCGCTCGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAA
CGAATGAAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTA
ACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAAC
AGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATG
ATCCGTCACATCCTGAATATATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG

Protein sequence :
MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIM
LTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIEL
THREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_012469.1.7685629. Protein 1e-70 63
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_003923.1003749.p0 Protein 2e-56 53
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002952.2859905.p0 Protein 2e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_007622.3794472.p0 Protein 2e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_009641.5332272.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_013450.8614421.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_007793.3914279.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002745.1124361.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_009782.5559369.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002951.3237708.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002758.1121668.p0 Protein 3e-56 52
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR HE999704.1.gene2815. Protein 6e-52 50
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_012469.1.7686381. Protein 4e-47 49
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AE016830.1.gene1681. Protein 4e-48 46
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AE000516.2.gene3505. Protein 8e-42 46
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AM180355.1.gene1830. Protein 2e-45 45
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_014475.1.orf0.gen Protein 3e-42 44
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AF130997.1.orf0.gene Protein 1e-41 44
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_005054.2598277.p0 Protein 3e-42 44
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR FJ349556.1.orf0.gene Protein 6e-41 44
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AF155139.2.orf0.gene Protein 2e-38 43
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR DQ212986.1.gene4.p01 Protein 1e-41 42
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_007622.3794948.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_003923.1003417.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_013450.8614146.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002951.3238224.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_007793.3914065.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002758.1121390.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_010079.5776364.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR NC_002952.2859858.p0 Protein 7e-36 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AE015929.1.gene1106. Protein 9e-31 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR HE999704.1.gene1528. Protein 4e-35 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR AF162694.1.orf4.gene Protein 6e-37 41
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR CP001918.1.gene5135. Protein 8e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SAKOR_00018 YP_008490202.1 Two-component response regulator VicR/WalR VFG1702 Protein 2e-37 41