Gene Information

Name : SBOV45841 (BN855_45640)
Accession : YP_008508356.1
Strain : Salmonella enterica 3114
Genome accession: NC_022241
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4567678 - 4568763 bp
Length : 1086 bp
Strand : +
Note : -

DNA sequence :
ATGGCACTAACAGATCGCGCTATAGTCCACGCCAAGCCTTGTGGCAAGCCGTATAAGCTCAGTGACTCGCATGGACTTTA
CCTGCTGGTTAACCCTAACGGTTCAAAACGCTGGTACATCAAGTACCGCTTTGTAAACAAAGAGAAAAAGCTCGCTTTAG
GCCCTTATCCGCTTTTGACGCTTGCACAGGCAAGACGCATGCGTGAAGAGGCCCAATTACTGCTGATTTCCGGCATCGAT
CCGAGTGCACACCGAAAGGCTGAACGTCTTGCTATAACGCCGGAACATACGTTTGAGTCTGTGGCTCGCGAATGGGTCAT
CAGTAACGTAAACTGGTCGGCGGAACATAAGAAGCGGGTGCTGCGTTACTTCGAGCTTTATGTGTTCCCCACGAACGGTA
GCTGTGACATCACCAAGATGAAGGTCAAAGATCTGCTGGTGCCCATCAAGGAGGTGGAGAAAGCGGGCAAACTGGATGTT
GCTTCCCGGCTTCAGCAACGCACTGCCTGCGTGATGCGCTATGCGGTGCAGAACGGCATTATCGATCATAACCCTGCATC
AGATTTAACCGGCGCGGTCTCTACGCCCAAAGTTCGTCATCACCCGGCGTTGGATCTGAATCTTATCCCTGATTTCCTGG
ATAGAATCGACGATTACAAAGGCCGTCAACTGACTCAACTGGCGGTAAAGCTGGCGCTGCTGCTGTTTATCCGCTCCAGC
GAACTGCGCTTTGCCCGCTGGGATGAGATTGATCTGCGTAACGCCATGTGGACCATCCCCGCTGAGCGTGAGCCGATCCC
CGGCGTTAAATATTCAGCGCGTGGGGCGAAGATGCACTCCCCACACCTGGTCCCATTGTCACGTCAGGCCATCGAACTGC
TGCACGAGGTGCGGCAGCATTGCCGACCGGGAACTGAACTGGTATTCCCCGGCGATCATAACTACCGCAAACCGATGAGC
GAAAACACCATCAACAAAGCGCTGCGGGTGATGGGCTACGACACCCAGAAAGACGTCTGTGGCCACGGTTTTCGCACTAT
GGCCTGTAGCGCGCTGGTGGAGTCAGGCCTGTGGTCATGTAAATAG

Protein sequence :
MALTDRAIVHAKPCGKPYKLSDSHGLYLLVNPNGSKRWYIKYRFVNKEKKLALGPYPLLTLAQARRMREEAQLLLISGID
PSAHRKAERLAITPEHTFESVAREWVISNVNWSAEHKKRVLRYFELYVFPTNGSCDITKMKVKDLLVPIKEVEKAGKLDV
ASRLQQRTACVMRYAVQNGIIDHNPASDLTGAVSTPKVRHHPALDLNLIPDFLDRIDDYKGRQLTQLAVKLALLLFIRSS
ELRFARWDEIDLRNAMWTIPAEREPIPGVKYSARGAKMHSPHLVPLSRQAIELLHEVRQHCRPGTELVFPGDHNYRKPMS
ENTINKALRVMGYDTQKDVCGHGFRTMACSALVESGLWSCK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 1e-101 60
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 1e-101 60
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 7e-94 57
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-95 57
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 2e-93 57
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 2e-95 57
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 1e-95 57
int AAL51028.1 CP4-like integrase Not tested LEE Protein 2e-95 57
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 7e-95 57
int-phe AAL60261.1 Int-phe Not tested LEE Protein 2e-95 57
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-95 57
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-95 57
int AAL51003.1 CP4-like integrase Not tested LEE Protein 9e-96 57
int AAK16198.1 Int Not tested PAI-I AL862 Protein 8e-96 57
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 8e-96 57
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 5e-94 57
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 2e-95 57
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 1e-94 57
int CAC81896.1 integrase Not tested LEE II Protein 2e-88 57
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 6e-92 57
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 2e-95 56
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 2e-95 56
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 2e-95 56
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 2e-95 56
int AAK00456.1 Int Not tested SHI-1 Protein 2e-88 56
int2 NP_993013.1 integrase Not tested HPI Protein 3e-83 54
int CAB59974.1 integrase Not tested HPI Protein 3e-83 54
int CAA21384.1 - Not tested HPI Protein 3e-83 54
int CAA08754.1 integrase Not tested HPI Protein 2e-83 54
int YP_002346908.1 integrase Not tested HPI Protein 3e-83 54
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 3e-83 54
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 7e-59 52
unnamed AAD17660.1 unknown Not tested HPI Protein 8e-81 52
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 1e-85 52
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 1e-85 52
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 1e-63 52
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 5e-72 49
int AAD44730.1 Int Not tested SHI-2 Protein 1e-58 42
int CAC39282.1 integrase Not tested LPA Protein 4e-59 42
aec33 AAW51716.1 Int Not tested AGI-3 Protein 2e-59 42
int AAC31482.1 CP4-like integrase Not tested LEE Protein 2e-57 41
int ACU09430.1 integrase Not tested LEE Protein 2e-57 41
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 3e-57 41
ECs4534 NP_312561.1 integrase Not tested LEE Protein 3e-57 41
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 5e-57 41
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 5e-57 41
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 4e-57 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SBOV45841 YP_008508356.1 hypothetical protein VFG1693 Protein 3e-95 57
SBOV45841 YP_008508356.1 hypothetical protein VFG1536 Protein 3e-92 57
SBOV45841 YP_008508356.1 hypothetical protein VFG0626 Protein 1e-95 56
SBOV45841 YP_008508356.1 hypothetical protein VFG0783 Protein 1e-57 41
SBOV45841 YP_008508356.1 hypothetical protein VFG0598 Protein 2e-57 41