Gene Information

Name : vicR (SCR2_1119)
Accession : YP_008511278.1
Strain : Streptococcus constellatus C818
Genome accession: NC_022245
Putative virulence/resistance : Virulence
Product : putative response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1142305 - 1143006 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATATTAGTTGTAGATGATGAGAAACCAATCTCAGATATTATAAAATTTAACATGGTAAAAGAAGGTTATGA
AGTAGTGACAGCCTTCAATGGTCGTGAAGCATTAGAGATGTTTGAAGCAGAACGTCCAGATATTTTGATTTTGGACTTGA
TGTTGCCTGAACTGGACGGCTTAGAGGTGGCGCGAACGATTCGGAAAACGAGCAATGTTCCCATCATCGTTCTTTCTGCC
AAAGACAGTGAATTTGATAAAGTCATTGGTCTCGAAATCGGAGCAGATGACTATATGACAAAGCCGTTTTCTAATCGTGA
GTTACAGGCGCGTGTCAAAGCTATTTTGCGTCGCACAGATTTGACAATTGAAAATCAAGAAGCAGAAGCTGCTCCGACAG
AAATTGTGATTGGAGATTTGCAGATTTTGACCGATGCTTTTGTCGTGAAAAAGCATGGTGAAGAATTGGATTTAACACAC
CGTGAGTTTGAATTGCTACACCATTTGGCCACGCATATCGGGCAAGTAATGACGCGTGAACATCTACTAGAAACGGTGTG
GGGATATGATTATTTTGGAGATGTTCGGACTGTTGATGTGACAATTCGCCGTTTGAGAGAGAAGATTGAGGATATTCCCA
GCCGACCAGAGTATATTTTAACGCGGCGCGGTGTTGGATATTATATGAGAAACAATGATTGA

Protein sequence :
MKKILVVDDEKPISDIIKFNMVKEGYEVVTAFNGREALEMFEAERPDILILDLMLPELDGLEVARTIRKTSNVPIIVLSA
KDSEFDKVIGLEIGADDYMTKPFSNRELQARVKAILRRTDLTIENQEAEAAPTEIVIGDLQILTDAFVVKKHGEELDLTH
REFELLHHLATHIGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDIPSRPEYILTRRGVGYYMRNND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_008511278.1 putative response transcriptional regulator NC_012469.1.7685629. Protein 2e-93 83
vicR YP_008511278.1 putative response transcriptional regulator NC_002952.2859905.p0 Protein 2e-56 56
vicR YP_008511278.1 putative response transcriptional regulator NC_009641.5332272.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_013450.8614421.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_007793.3914279.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_007622.3794472.p0 Protein 1e-56 56
vicR YP_008511278.1 putative response transcriptional regulator NC_002745.1124361.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_009782.5559369.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_002951.3237708.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_003923.1003749.p0 Protein 8e-57 56
vicR YP_008511278.1 putative response transcriptional regulator NC_002758.1121668.p0 Protein 9e-57 56
vicR YP_008511278.1 putative response transcriptional regulator HE999704.1.gene2815. Protein 1e-55 55
vicR YP_008511278.1 putative response transcriptional regulator NC_012469.1.7686381. Protein 9e-47 48
vicR YP_008511278.1 putative response transcriptional regulator AE016830.1.gene1681. Protein 5e-49 47
vicR YP_008511278.1 putative response transcriptional regulator AF155139.2.orf0.gene Protein 1e-39 44
vicR YP_008511278.1 putative response transcriptional regulator FJ349556.1.orf0.gene Protein 8e-41 44
vicR YP_008511278.1 putative response transcriptional regulator HE999704.1.gene1528. Protein 6e-37 43
vicR YP_008511278.1 putative response transcriptional regulator AM180355.1.gene1830. Protein 2e-37 43
vicR YP_008511278.1 putative response transcriptional regulator NC_014475.1.orf0.gen Protein 2e-37 42
vicR YP_008511278.1 putative response transcriptional regulator NC_005054.2598277.p0 Protein 2e-37 42
vicR YP_008511278.1 putative response transcriptional regulator AE000516.2.gene3505. Protein 1e-37 42
vicR YP_008511278.1 putative response transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 41
vicR YP_008511278.1 putative response transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-36 41
vicR YP_008511278.1 putative response transcriptional regulator AF130997.1.orf0.gene Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_008511278.1 putative response transcriptional regulator VFG1389 Protein 3e-34 45
vicR YP_008511278.1 putative response transcriptional regulator VFG1563 Protein 6e-37 44
vicR YP_008511278.1 putative response transcriptional regulator VFG1702 Protein 8e-37 43
vicR YP_008511278.1 putative response transcriptional regulator VFG1390 Protein 2e-37 41