Gene Information

Name : Ser39006_2830 (Ser39006_2830)
Accession : YP_008523212.1
Strain : Serratia sp. ATCC 39006
Genome accession: NC_022268
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3115713 - 3116288 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: terE, tellurite resistance protein

DNA sequence :
ATGGCAGTTTCTCTGATTAAAGGCGGCAACGTATCCTTAACTAAAGAAGCACCAACCATGAATGTGGCAATGGTAGGTCT
GGGCTGGGATGCTCGCGTGACTGATGGCGCTGAATTTGACCTTGACGCTTCCGTGTTTATGGTTGGCGAAAGCGGTGAGG
TCGTCTCGGACGCAGGCTTCATTTTCTTTAATAACAAAACGAGTGCATGTGGCTCTGTTACCCATATGGGAGACAACCGT
ACCGGTGAAGGTGAAGGTGATGATGAACAGGTGAAAATTGACCTGGCCAAGGTCCCTGCCGATGTCAAAAAACTGGTGTT
CGCTGTTACCATTTATGATGCAGAAGCCCGTAAGCAAAACTTTGGCATGGTCAGCAACAGCTATATGCGAGTGTTTAATA
ACGACAATAGCACCGAAATTGCCCGTTTCGACCTGTCTGAAGATGCATCCACCGAAACTGCCATGGTATTTGGTGAACTG
TATCGCCATAACGCAGAATGGAAATTCAAAGCTGTCGGTCAAGGCTTCGCCGGCGGCCTGTCCGCACTGGCATCTCAACA
CGGCGTGAACATCTGA

Protein sequence :
MAVSLIKGGNVSLTKEAPTMNVAMVGLGWDARVTDGAEFDLDASVFMVGESGEVVSDAGFIFFNNKTSACGSVTHMGDNR
TGEGEGDDEQVKIDLAKVPADVKKLVFAVTIYDAEARKQNFGMVSNSYMRVFNNDNSTEIARFDLSEDASTETAMVFGEL
YRHNAEWKFKAVGQGFAGGLSALASQHGVNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-75 88
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-75 88
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-75 88
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-65 73
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-58 63

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ser39006_2830 YP_008523212.1 stress protein BAC0390 Protein 3e-73 82
Ser39006_2830 YP_008523212.1 stress protein BAC0389 Protein 1e-58 65