Gene Information

Name : Ser39006_2831 (Ser39006_2831)
Accession : YP_008523213.1
Strain : Serratia sp. ATCC 39006
Genome accession: NC_022268
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3116365 - 3116943 bp
Length : 579 bp
Strand : -
Note : PFAM: stress protein; KEGG: terD, tellurium resistance protein terD

DNA sequence :
ATGGGAGTTTCTCTTTCTAAAGGTGGTAATGTTTCTTTAAGCAAAGAAGCACCAACAATGAAAAATATGTTGGTGGGTCT
GGGCTGGGATGCTCGCTCAACCGACGGACAGGATTTTGACCTTGATGCGTCAGCGTTTCTGCTTGCCAGCAGTGGCAAGG
TACGCGGAGATGCAGACTTCATTTTCTATAATAATCTGAAATCATCCGATGGTTCCGTTCTGCACACGGGTGATAACCGC
ACGGGTGAAGGCGATGGTGATGATGAAGCACTGAAGATCAAACTCGACCAGATCCCGGCAGACGTAGATAAGATCGTATT
CGTGGTCACCATCCACGATGCGACGGCTCGTCGCCAGAGCTTCGGCCAGGTTTCTGGCGCCTTCATTCGCTTGGTAAATG
ACGATAATCACGTTGAAGTCGCTCGCTATGATCTGACTGAAGATGCGTCAACAGAAACCGCGATGTTGTTTGGTGAGTTA
TATCGCCATGGCACCGAGTGGAAATTCCGTGCAGTAGGCCAGGGCTATGCGGGTGGTCTGAACTCCGTGTGTGCACAGTA
CGGTATCAACGCGTCTTAA

Protein sequence :
MGVSLSKGGNVSLSKEAPTMKNMLVGLGWDARSTDGQDFDLDASAFLLASSGKVRGDADFIFYNNLKSSDGSVLHTGDNR
TGEGDGDDEALKIKLDQIPADVDKIVFVVTIHDATARRQSFGQVSGAFIRLVNDDNHVEVARYDLTEDASTETAMLFGEL
YRHGTEWKFRAVGQGYAGGLNSVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-79 90
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-79 90
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-78 90
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-66 71
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-59 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-56 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ser39006_2831 YP_008523213.1 stress protein BAC0389 Protein 2e-78 90
Ser39006_2831 YP_008523213.1 stress protein BAC0390 Protein 5e-63 68