
|
Name : LY180_21335 (LY180_21335) Accession : YP_008567277.1 Strain : Escherichia coli LY180 Genome accession: NC_022364 Putative virulence/resistance : Resistance Product : transcriptional regulator Function : - COG functional category : - COG ID : - EC number : - Position : 4466859 - 4467182 bp Length : 324 bp Strand : - Note : regulates genes involved in response to oxidative stress; Derived by automated computational analysis using gene prediction method: Protein Homology. DNA sequence : ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGAGCATATTGACCAGCCGCTTAACATTGATGTAGT CGCAAAAAAATCAGGCTATTCAAAGTGGTACTTGCAACGAATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACA TTCGCCAACGCCGCCTGTTACTGGCCGCCGTTGAGTTGCGCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTG GGTTATGTCTCGCAGCAGACCTTCTCCCGCGTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCT GTAA Protein sequence : MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDL GYVSQQTFSRVFRRQFDRTPSDYRHRL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| soxS | YP_219131.1 | DNA-binding transcriptional regulator SoxS | Not tested | SPI-4 | Protein | 2e-45 | 96 |
| tetD | AAL08447.1 | putative transcriptional regulator TetD | Not tested | SRL | Protein | 9e-22 | 51 |
| tetD | AEA34665.1 | tetracycline resistance protein D | Not tested | Not named | Protein | 9e-22 | 51 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | NC_002695.1.914293.p | Protein | 4e-47 | 100 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | BAC0371 | Protein | 4e-47 | 100 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP000034.1.gene4505. | Protein | 7e-47 | 99 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP001138.1.gene4488. | Protein | 7e-46 | 96 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP001918.1.gene327.p | Protein | 6e-44 | 90 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP000647.1.gene4499. | Protein | 2e-43 | 89 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | NC_010558.1.6276025. | Protein | 4e-22 | 51 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP001138.1.gene612.p | Protein | 5e-24 | 46 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP000647.1.gene1624. | Protein | 8e-20 | 43 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP001918.1.gene2033. | Protein | 1e-19 | 43 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | NC_002695.1.917339.p | Protein | 1e-19 | 42 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP001138.1.gene1637. | Protein | 2e-19 | 42 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | BAC0560 | Protein | 1e-19 | 42 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | CP000034.1.gene1596. | Protein | 1e-19 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | VFG0585 | Protein | 6e-46 | 96 |
| LY180_21335 | YP_008567277.1 | transcriptional regulator | VFG1038 | Protein | 4e-22 | 51 |