Gene Information

Name : kw2_1549 (kw2_1549)
Accession : YP_008569192.1
Strain : Lactococcus lactis KW2
Genome accession: NC_022369
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1637234 - 1637926 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGGCATCAAAGAAAATTTTGATTATTGAGGATGAAAAGAATTTAGCTCGTTTCGTCTCATTAGAATTAGAGCATGAAGG
CTATGCCACTGAGATTAAAGATAACGGACGTTCTGGGCTTGAAGAAGCAACTTCAAAAGATTATGATTTAATCTTGCTTG
ATTTGATGCTTCCTGAACTTGATGGTTTTGAAGTTGCCCGCCGTTTGCGCAAAGAAAAAGATACTCCAATTATTATGATG
ACCGCGCGTGATTCAACAATGGACCGTGTTGCCGGTCTTGATATTGGAGCAGATGATTATATTACTAAGCCTTTTGCGAT
TGAAGAACTTTTGGCTCGTGTTCGTGCATTCTTCCGTCGTGAAGAACATGGTCACGCTGTAGAACGTGCTGAAAACACTT
CTTTTCGTGATCTTGTAATTGACAAAACAAATCGTACCGTTCACCGTGGTAAAAAAGTAATTGATTTGACGCGTCGTGAA
TACGATCTTCTTTTGACATTGATGCAAAATGTTGGGGATGTTGTCACTCGCGAACATTTAGTTTCACAAGTTTGGGGATA
TGAAGAAGGAACGGAAACAAATGTTGTTGATGTATATATCCGCTATCTTAGAAATAAAATTGATGTTGAAGGACAAGACA
GCTATATTCAAACCGTTCGTGGTTTGGGTTATGTGATGCGTGAACGCAAATAA

Protein sequence :
MASKKILIIEDEKNLARFVSLELEHEGYATEIKDNGRSGLEEATSKDYDLILLDLMLPELDGFEVARRLRKEKDTPIIMM
TARDSTMDRVAGLDIGADDYITKPFAIEELLARVRAFFRREEHGHAVERAENTSFRDLVIDKTNRTVHRGKKVIDLTRRE
YDLLLTLMQNVGDVVTREHLVSQVWGYEEGTETNVVDVYIRYLRNKIDVEGQDSYIQTVRGLGYVMRERK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-31 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
kw2_1549 YP_008569192.1 two component system response regulator HE999704.1.gene1528. Protein 2e-56 63
kw2_1549 YP_008569192.1 two component system response regulator NC_003923.1003417.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_013450.8614146.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_002951.3238224.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_007793.3914065.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_002758.1121390.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_010079.5776364.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_002952.2859858.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator NC_007622.3794948.p0 Protein 1e-44 52
kw2_1549 YP_008569192.1 two component system response regulator AE015929.1.gene1106. Protein 4e-42 52
kw2_1549 YP_008569192.1 two component system response regulator BAC0308 Protein 1e-32 44
kw2_1549 YP_008569192.1 two component system response regulator BAC0125 Protein 1e-31 44
kw2_1549 YP_008569192.1 two component system response regulator NC_012469.1.7685629. Protein 7e-35 44
kw2_1549 YP_008569192.1 two component system response regulator BAC0197 Protein 4e-32 43
kw2_1549 YP_008569192.1 two component system response regulator AE016830.1.gene1681. Protein 2e-34 42
kw2_1549 YP_008569192.1 two component system response regulator BAC0111 Protein 3e-31 42
kw2_1549 YP_008569192.1 two component system response regulator NC_012469.1.7686381. Protein 1e-34 41
kw2_1549 YP_008569192.1 two component system response regulator BAC0083 Protein 2e-31 41
kw2_1549 YP_008569192.1 two component system response regulator HE999704.1.gene2815. Protein 1e-33 41
kw2_1549 YP_008569192.1 two component system response regulator BAC0638 Protein 1e-25 41
kw2_1549 YP_008569192.1 two component system response regulator AE000516.2.gene3505. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
kw2_1549 YP_008569192.1 two component system response regulator VFG0596 Protein 1e-31 46
kw2_1549 YP_008569192.1 two component system response regulator VFG1390 Protein 5e-41 45
kw2_1549 YP_008569192.1 two component system response regulator VFG1389 Protein 2e-32 41