Gene Information

Name : kw2_0396 (kw2_0396)
Accession : YP_008568064.1
Strain : Lactococcus lactis KW2
Genome accession: NC_022369
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 396755 - 397456 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAATTCTTGTTGTTGATGATGAAAAACCAATCTCAGATATCGTAAAATTTAATTTAACCAAAGAAGGTTTTGA
AGTATTTACAGCTTTCGATGGCGAAGAAGCCCTTGAAGCTTTTAAAGAAGTACAACCTGACCTTATTTTACTTGATTTGA
TGTTACCAAAACTTGACGGTCTTGATGTTGCACGTGAAATCCGTAAAACCTCTGACACTCCTATTATCATGGTGTCAGCT
AAAGATAGCGAGTTTGATAAAGTTATTGGACTTGAACTTGGTGCAGATGACTATGTCACTAAACCATTTTCAAATCGCGA
ACTTTTAGCTCGTATTAAAGCAAACTTGCGTCGTATCAATGTCGCACCTGCTGAATCTACTGATAATGTTAAGAAAGAAT
TGATTATCGGAAATCTCCGTATCAATCCAGCGCATTATGCTGCTTACAAAAATGATAAACAACTTGACCTCACACACCGT
GAGTTTGAATTACTTTATTATCTTGCTCAACACCTCGGCGAAGTTATCACTCGTGAAAATCTTTTGGAAACAGTTTGGGG
CTACGATTACTTTGGTGATGTGCGTACAGTTGACGTTACAGTCCGCCGCTTGCGTGAAAAAGTTGAAGATACACCAAGCC
GTCCACAATACGTTTCAACACGCCGCGGGGTTGGCTATTACATGAGCAACCCACATGATTAA

Protein sequence :
MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAFKEVQPDLILLDLMLPKLDGLDVAREIRKTSDTPIIMVSA
KDSEFDKVIGLELGADDYVTKPFSNRELLARIKANLRRINVAPAESTDNVKKELIIGNLRINPAHYAAYKNDKQLDLTHR
EFELLYYLAQHLGEVITRENLLETVWGYDYFGDVRTVDVTVRRLREKVEDTPSRPQYVSTRRGVGYYMSNPHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-25 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
kw2_0396 YP_008568064.1 two component system response regulator NC_012469.1.7685629. Protein 4e-63 73
kw2_0396 YP_008568064.1 two component system response regulator HE999704.1.gene2815. Protein 2e-41 53
kw2_0396 YP_008568064.1 two component system response regulator NC_003923.1003749.p0 Protein 1e-46 52
kw2_0396 YP_008568064.1 two component system response regulator NC_002952.2859905.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_002758.1121668.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_007622.3794472.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_009641.5332272.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_013450.8614421.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_007793.3914279.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_002745.1124361.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_009782.5559369.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_002951.3237708.p0 Protein 1e-46 51
kw2_0396 YP_008568064.1 two component system response regulator NC_012469.1.7686381. Protein 2e-37 51
kw2_0396 YP_008568064.1 two component system response regulator AE016830.1.gene1681. Protein 4e-38 48
kw2_0396 YP_008568064.1 two component system response regulator AE000516.2.gene3505. Protein 4e-25 46
kw2_0396 YP_008568064.1 two component system response regulator CP004022.1.gene3215. Protein 2e-29 46
kw2_0396 YP_008568064.1 two component system response regulator CP001138.1.gene4273. Protein 1e-30 46
kw2_0396 YP_008568064.1 two component system response regulator CP001918.1.gene5135. Protein 5e-26 46
kw2_0396 YP_008568064.1 two component system response regulator CP000647.1.gene4257. Protein 9e-31 45
kw2_0396 YP_008568064.1 two component system response regulator NC_002695.1.915041.p Protein 8e-30 45
kw2_0396 YP_008568064.1 two component system response regulator BAC0533 Protein 9e-31 45
kw2_0396 YP_008568064.1 two component system response regulator CP000034.1.gene3834. Protein 8e-30 45
kw2_0396 YP_008568064.1 two component system response regulator NC_005054.2598277.p0 Protein 1e-31 43
kw2_0396 YP_008568064.1 two component system response regulator NC_014475.1.orf0.gen Protein 1e-31 43
kw2_0396 YP_008568064.1 two component system response regulator HE999704.1.gene1528. Protein 2e-21 42
kw2_0396 YP_008568064.1 two component system response regulator AF162694.1.orf4.gene Protein 5e-27 42
kw2_0396 YP_008568064.1 two component system response regulator FJ349556.1.orf0.gene Protein 3e-30 42
kw2_0396 YP_008568064.1 two component system response regulator AE015929.1.gene1106. Protein 6e-21 42
kw2_0396 YP_008568064.1 two component system response regulator NC_010400.5986590.p0 Protein 6e-23 42
kw2_0396 YP_008568064.1 two component system response regulator NC_011595.7057856.p0 Protein 2e-23 42
kw2_0396 YP_008568064.1 two component system response regulator NC_010410.6002989.p0 Protein 2e-23 42
kw2_0396 YP_008568064.1 two component system response regulator BAC0039 Protein 3e-21 42
kw2_0396 YP_008568064.1 two component system response regulator CP000034.1.gene2186. Protein 3e-21 42
kw2_0396 YP_008568064.1 two component system response regulator NC_002695.1.916589.p Protein 2e-21 42
kw2_0396 YP_008568064.1 two component system response regulator AM180355.1.gene1830. Protein 1e-28 41
kw2_0396 YP_008568064.1 two component system response regulator AF155139.2.orf0.gene Protein 1e-28 41
kw2_0396 YP_008568064.1 two component system response regulator NC_003923.1003417.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_013450.8614146.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_002951.3238224.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_007793.3914065.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_002758.1121390.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_010079.5776364.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_002952.2859858.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator NC_007622.3794948.p0 Protein 1e-25 41
kw2_0396 YP_008568064.1 two component system response regulator CP000647.1.gene2531. Protein 2e-21 41
kw2_0396 YP_008568064.1 two component system response regulator CP001138.1.gene2239. Protein 3e-20 41
kw2_0396 YP_008568064.1 two component system response regulator CP001918.1.gene3444. Protein 2e-20 41
kw2_0396 YP_008568064.1 two component system response regulator BAC0596 Protein 3e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
kw2_0396 YP_008568064.1 two component system response regulator VFG1389 Protein 3e-23 44
kw2_0396 YP_008568064.1 two component system response regulator VFG1563 Protein 4e-25 42
kw2_0396 YP_008568064.1 two component system response regulator VFG1702 Protein 1e-24 42