Gene Information

Name : O159_06490 (O159_06490)
Accession : YP_008579401.1
Strain : Leifsonia xyli DSM 46306
Genome accession: NC_022438
Putative virulence/resistance : Virulence
Product : two-component system regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 613535 - 614218 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
GTGACAAGCATCCTGCTCGTCGAGGATGAGGCCGCGTTGAGCGAGCCACTCGCATACCTGCTGAAGCGCGAGGGCTATGA
GGTCGCCGTCGCCGAGGACGGCCCGACCGCGCTCGCCGAGTTCGACCGCCTCGGCGCCGACCTCGTCCTGCTCGACCTCA
TGCTGCCGGGCATCCCGGGCACCGAAGTGTGCCGCGAGATCCGGACGCGCTCGAGCGTGCCGATCATCATGCTCACCGCG
AAGGACTCCGAGGTGGACATCGTGGTCGGGCTCGAACTCGGCGCGGACGACTATGTGACCAAGCCGTACTCCTCGCGCGA
ACTGCTCGCGCGCATCCGGGCGGTGCTGCGACGCCGGGTGGACGAAGCGGAGCGGGAGGATGACGGAGTCCTGGAGGCCG
GCACCGTCCGCATGGATGTGGACCGTCATACCGTGGCGGTGAACGGCGCCGAGATCTCCATGCCGCTCAAGGAATTCGAG
CTTCTCGAACTGCTGCTGCGCAACGCCGGGCGCGTGCTCACGCGCGGGCAGCTGATCGACCGAGTGTGGGGGAGCGATTA
CTTCGGCGACACCAAGACGCTGGATGTCCACATCAAGCGCATCCGCTCGCGCATCGAGGAGAGCCCGTCGGACCCGCAGA
TGCTCGTCACCGTGCGCGGACTGGGCTATCGCTTCAACAGCTGA

Protein sequence :
MTSILLVEDEAALSEPLAYLLKREGYEVAVAEDGPTALAEFDRLGADLVLLDLMLPGIPGTEVCREIRTRSSVPIIMLTA
KDSEVDIVVGLELGADDYVTKPYSSRELLARIRAVLRRRVDEAEREDDGVLEAGTVRMDVDRHTVAVNGAEISMPLKEFE
LLELLLRNAGRVLTRGQLIDRVWGSDYFGDTKTLDVHIKRIRSRIEESPSDPQMLVTVRGLGYRFNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-15 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-15 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O159_06490 YP_008579401.1 two-component system regulatory protein NC_012469.1.7685629. Protein 9e-32 45
O159_06490 YP_008579401.1 two-component system regulatory protein AE000516.2.gene3505. Protein 6e-32 45
O159_06490 YP_008579401.1 two-component system regulatory protein NC_002952.2859905.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_002951.3237708.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_003923.1003749.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_007622.3794472.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_002758.1121668.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_009641.5332272.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_013450.8614421.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_007793.3914279.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_002745.1124361.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_009782.5559369.p0 Protein 2e-27 44
O159_06490 YP_008579401.1 two-component system regulatory protein NC_012469.1.7686381. Protein 2e-26 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O159_06490 YP_008579401.1 two-component system regulatory protein VFG0596 Protein 5e-16 41