Gene Information

Name : KQS_05010 (KQS_05010)
Accession : YP_005357025.1
Strain : Flavobacterium indicum GPTSA100-9
Genome accession: NC_017025
Putative virulence/resistance : Virulence
Product : two-component system response regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1101303 - 1101986 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGATGAATGTTTTAATTATAGAAGACGATACAAGAATTGCTGAACTTATCCAAAGAGGACTGCAAGAACAAGGTTTTGT
TCCGACATTGGCGTATGACGGACTTTCGGGAAAGAAACTGGCTTTACAAAACGACTATGACTTAATAATTACCGACATCA
TTTTGCCGAAAATGGATGGACTTGATTTGTGCAAAGAAATACGGCAAACCAAACCTGACACGCCAATTATTATGCTGACC
GCTCTTGGCACAACGGATGACAAAGTGGAAGGTTTTGATGCAGGAGCAGACGACTACCTTGTAAAACCTTTTGAAATGCG
TGAATTATTAGTTCGAATCCGTGCATTGCTGAAGCGACAAAGCAAAACAACAAACAATACAGGCAATACACTTAAATATG
CCGACCTTGAAATGAATTTGCATACAAAAATTGTAAGGCGAAATGGCCTTGAAATTAATCTTACTCCAAAGGAATTTAAT
CTTTTGGAATATATGCTGCAAAATCCAGAGAGGGTTTTATCAAGAGTAGAAATTGCCGAAAAGGTTTGGGACACACATTT
TGACACTGGCACTAATTTCATTGATGTTTACATCAATTATTTAAGAAAGAAAATTGAAAAGGATTTTGACAAAAAACTCA
TTCATACCAAATCGGGTATGGGCTTTATTTTGAAAGTGGAATAA

Protein sequence :
MMNVLIIEDDTRIAELIQRGLQEQGFVPTLAYDGLSGKKLALQNDYDLIITDIILPKMDGLDLCKEIRQTKPDTPIIMLT
ALGTTDDKVEGFDAGADDYLVKPFEMRELLVRIRALLKRQSKTTNNTGNTLKYADLEMNLHTKIVRRNGLEINLTPKEFN
LLEYMLQNPERVLSRVEIAEKVWDTHFDTGTNFIDVYINYLRKKIEKDFDKKLIHTKSGMGFILKVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-39 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-39 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KQS_05010 YP_005357025.1 two-component system response regulatory protein BAC0111 Protein 2e-48 48
KQS_05010 YP_005357025.1 two-component system response regulatory protein BAC0125 Protein 6e-46 47
KQS_05010 YP_005357025.1 two-component system response regulatory protein BAC0347 Protein 2e-42 44
KQS_05010 YP_005357025.1 two-component system response regulatory protein AE015929.1.gene1106. Protein 1e-32 42
KQS_05010 YP_005357025.1 two-component system response regulatory protein BAC0308 Protein 5e-40 42
KQS_05010 YP_005357025.1 two-component system response regulatory protein BAC0083 Protein 8e-42 42
KQS_05010 YP_005357025.1 two-component system response regulatory protein BAC0638 Protein 1e-36 42
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_007622.3794948.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_003923.1003417.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_013450.8614146.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_002951.3238224.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_007793.3914065.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_002758.1121390.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_010079.5776364.p0 Protein 4e-37 41
KQS_05010 YP_005357025.1 two-component system response regulatory protein NC_002952.2859858.p0 Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KQS_05010 YP_005357025.1 two-component system response regulatory protein VFG0596 Protein 4e-40 43
KQS_05010 YP_005357025.1 two-component system response regulatory protein VFG1390 Protein 2e-45 41