Gene Information

Name : Gmet_1026 (Gmet_1026)
Accession : YP_006719993.1
Strain : Geobacter metallireducens GS-15
Genome accession: NC_007517
Putative virulence/resistance : Virulence
Product : winged-helix transcriptional response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1141939 - 1142613 bp
Length : 675 bp
Strand : +
Note : 'domains: REC, trans_reg_C'

DNA sequence :
ATGAAAATCCTCATTATCGAAGACGAAAAGAGAATGGCCGGGATTCTGAAAAAGGGGCTCGAGGAAAACGCCTTCATCGT
CGACCTGGCCGGCGACGGTGAAGAAGGGTTGTACATGGCCGAGAACTATCCCTACGACGCGGTACTGCTCGACATCATGC
TCCCGGTCATGGACGGCCTCTCGATCCTGAGCGCGTTGCGGTCGAAGAGAAGCGAGGTACCGGTCCTCCTGATCACCGCC
CGGGGGGAGATCGAGAGCAGAATAAAGGGGCTCAATTTCGGAGCGGATGACTATATCGTGAAGCCCTTTGACTTTCATGA
ACTCCTGGCGCGGCTGAAATCGGTGATCCGGAGGAGCAAGGGGAGACCTTCACCCCTTGTTGCAATCGACGACCTATCAC
TGGACACGAACTCCCGGAGCGTATGCCGCGGCGGGAGAGAGATCCGCCTGTCCGCTACCGAATACAATCTCCTTGAATAC
CTGGCGCTGAACAGCGGCAGGGTAATCAGCAGGACTGAACTTACGGAGCATATCTACGACACGGACTTCGACCGCGACAG
CAACGTCATCGACGTCTATGTGAACCACCTGCGAAACAAGCTGGATAAGGGCTTTGACCGACAGCTCATCCACACGGTGC
GGGGCGCGGGCTACATCCTGAAAGGCGATGCATGA

Protein sequence :
MKILIIEDEKRMAGILKKGLEENAFIVDLAGDGEEGLYMAENYPYDAVLLDIMLPVMDGLSILSALRSKRSEVPVLLITA
RGEIESRIKGLNFGADDYIVKPFDFHELLARLKSVIRRSKGRPSPLVAIDDLSLDTNSRSVCRGGREIRLSATEYNLLEY
LALNSGRVISRTELTEHIYDTDFDRDSNVIDVYVNHLRNKLDKGFDRQLIHTVRGAGYILKGDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-43 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-42 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0125 Protein 8e-51 47
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0111 Protein 1e-47 47
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0197 Protein 2e-48 46
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0347 Protein 2e-41 45
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0308 Protein 2e-48 45
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0638 Protein 4e-39 43
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator BAC0083 Protein 4e-42 42
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_007793.3914065.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_002758.1121390.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_010079.5776364.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_002952.2859858.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_007622.3794948.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_003923.1003417.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_013450.8614146.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_002951.3238224.p0 Protein 1e-36 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator NC_002516.2.879194.p Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator VFG0596 Protein 1e-43 42
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator VFG1390 Protein 1e-41 41
Gmet_1026 YP_006719993.1 winged-helix transcriptional response regulator VFG1389 Protein 1e-36 41