Gene Information

Name : pipB (STM474_1080)
Accession : YP_005241984.1
Strain : Salmonella enterica ST4/74
Genome accession: NC_016857
Putative virulence/resistance : Virulence
Product : secreted effector protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1132772 - 1133647 bp
Length : 876 bp
Strand : -
Note : -

DNA sequence :
ATGCCAATAACTAACGCGTCCCCAGAAAATATATTAAGATATTTGCATGCGGCCGGTACCGGTACGAAAGAAGCAATGAA
AAGTGCAACTTCACCACGCGGTATACTGGAATGGTTTGTCAATTTTTTTACCTGTGGTGGAGTAAGAAGAAGCAATGAAA
GATGGTTTCGGGAGGTAATTGGAAAACTGACCACATCATTATTATATGTAAATAAAAATGCTTTCTTCGATGGTAATAAA
ATATTTCTGGAGGATGTCAACGGGTGTACTATATGTCTGTCATGTGGAGCAGCATCCGAAAATACGGATCCCATGGTCAT
TATTGAAGTGAACAAAAATGGAAAAACTGTAACGGATAAAGTTGATAGTGAGAGATTTTGGAATGTATGTCGAATGTTAA
AACTGATGAGTAAACATAATATACAACAGCCTGATTCACTTATAACCGAGGATGGTTTTCTGAACCTGCGCGGAGTAAAC
CTGGCTCATAAAGATTTCCAGGGGGAAGATTTGTCAAAAATAGATGCTTCTAATGCAGATTTCCGTGAAACAACTCTATC
TAATGTAAATTTAGTCGGTGCAAATTTGTGTTGTGCAAATCTACACGCTGTAAATCTAATGGGTTCAAACATGACTAAAG
CAAACCTGACTCACGCAGACCTGACTTGCGCTAACATGTCCGGTGTAAACTTAACCGCTGCAATTCTATTCGGCTCAGAC
TTAACTGACACCAAACTAAATGGTGCGAAATTAGATAAGATAGCTCTAACTTTAGCGAAAGCATTAACAGGAGCCGATCT
GACAGGTAGTCAACATACCCCTACTCCACTCCCGGATTACAATGATAGAACTCTTTTCCCCCATCCGATATTTTAG

Protein sequence :
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERWFREVIGKLTTSLLYVNKNAFFDGNK
IFLEDVNGCTICLSCGAASENTDPMVIIEVNKNGKTVTDKVDSERFWNVCRMLKLMSKHNIQQPDSLITEDGFLNLRGVN
LAHKDFQGEDLSKIDASNADFRETTLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHADLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKALTGADLTGSQHTPTPLPDYNDRTLFPHPIF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pipB NP_460061.1 secreted effector protein Virulence SPI-5 Protein 1e-132 100
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 Virulence SPI-5 Protein 6e-132 99
pipB AAC33725.1 PipB Virulence SPI-5 Protein 2e-128 98
pipB NP_455586.1 conserved hypothetical protein Virulence SPI-5 Protein 1e-127 98

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pipB YP_005241984.1 secreted effector protein VFG0589 Protein 4e-133 100