Gene Information

Name : Apar_1044 (Apar_1044)
Accession : YP_003180063.1
Strain : Atopobium parvulum DSM 20469
Genome accession: NC_013203
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1180510 - 1181214 bp
Length : 705 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcb:BCB4264_A2673 DNA-binding response regulator

DNA sequence :
ATGATTAAGGTTCTTATCGTTGAAGACGAAGAAAAAATTGCACGCTTTATAGAACTCGAACTTAAACACGAGGGCTATGA
AGTAGACAAAGCTCTTGACGGAAGAACCGGCGCTGAGAAAGCGCTGACAAATGACTACGACCTTATCTTACTTGATATAC
TTCTTCCCCAACTTAATGGTCTAGAAGTTCTTAGAAGGATTCGTCGCGAGAAAAACACGCCAACTATCATGCTTACTGCT
CGTGATTCAGTTATGGATAAAGTTGCTGGTCTTGATGCGGGCGCAGATGACTATCTCACCAAGCCTTTTGCGATTGAAGA
ACTTCTCGCCCGCATTCGAGTGGCGCTCAAGCATCACGAGGTGGACAGCACAAGCTCACAGATTCCCTCCAACGTTCCAA
CAAAAAACGTTTTTACAATTAAGGGTGTCTCTCTTGATGTAGACCGTAGAGAAGTCTGCGTCAATAACAATTCGATTGAG
TTGACAACTAAAGAATTTGAAGTGCTTCGCATGCTTATGGAACACGCTGGTGTTGTCTTGAGTCGGGAACGCATTGCATC
AGAAGCTCTCGGGTATGAGTTTGCGGGAGAAACTAATAACGTAGATGTCCACATTGCTCATCTACGCGCAAAAATTGACG
ATCAATATAATATCAAGCTAATTACTACTGTACGTGGAGTTGGGTATGTCATCAGAGAAATCTAA

Protein sequence :
MIKVLIVEDEEKIARFIELELKHEGYEVDKALDGRTGAEKALTNDYDLILLDILLPQLNGLEVLRRIRREKNTPTIMLTA
RDSVMDKVAGLDAGADDYLTKPFAIEELLARIRVALKHHEVDSTSSQIPSNVPTKNVFTIKGVSLDVDRREVCVNNNSIE
LTTKEFEVLRMLMEHAGVVLSRERIASEALGYEFAGETNNVDVHIAHLRAKIDDQYNIKLITTVRGVGYVIREI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-42 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-42 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-39 50
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-44 49
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-39 47
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-35 44
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-38 44
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-33 43
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-37 43
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-36 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-36 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-31 42
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-39 41
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 7e-28 41
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 7e-28 41
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-34 41
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-42 48
Apar_1044 YP_003180063.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-30 41