Gene Information

Name : B479_00550 (B479_00550)
Accession : YP_007226971.1
Strain : Pseudomonas putida PC9
Genome accession: NC_019905
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 122701 - 123375 bp
Length : 675 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGAATTCTGGTAATTGAGGATGAAGTAAAAACTGCGGAGTATGTGCGTCAAGGTCTGACGGAATGTGGCTATGTCGT
AGATTGCGTCCACACCGGGTCAGATGGATTATTCTTGGCTAAGCAGCACGAATATGAGCTGATTATCCTGGATATAAATC
TGCCAGAGATGGACGGTTGGCAGGTCCTTGAGTTGTTGCGTCGTAAAAACTGCCCTTCCCGTATCATGATGCTGACGGCG
AGAAGCCGGCTGGCGGATAAGGTCCGGGGGCTGGAGAACGGAGCAGATGACTACCTGATCAAGCCATTTGAGTTCCCTGA
GCTGCTGGCCCGGGTTCGCGCCTTGATGCGCAGGTCAGATCACCCTGCATCCGTAGAGGTCATTCGCGTCGCTGACCTGG
AGCTTGATCAGAGCCGGCACAGGGCATTCAGGGACGGTCAGCGCATTGACCTGACCACGAAAGAATTCGCGTTACTGCAT
TACCTGATGCGTAATACCGGTGTGGTGCTGAGCCGCACCCAAATTATTTCGCAGGTTTGGGATATGAATTTTGACTGCGA
CACAAACGTTGTAGAGGTGTCGATTCGAAGACTCAGAGCCAAGATAGATGACCCTTTCGAGACCAAACTGATACATACGC
TTCGGGGCGTAGGGTATGTGCTTGAAAAACGATAG

Protein sequence :
MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEYELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTA
RSRLADKVRGLENGADDYLIKPFEFPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLH
YLMRNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-55 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-54 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-62 59
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0125 Protein 8e-61 58
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-57 56
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-54 56
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-56 54
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-59 53
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-54 49
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 4e-30 41
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 4e-31 41
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-55 55
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator VFG1389 Protein 6e-35 45
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator VFG1390 Protein 9e-37 42
B479_00550 YP_007226971.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-36 41