Gene Information

Name : yedW (ES15_0106)
Accession : YP_006341190.1
Strain : Cronobacter sakazakii ES15
Genome accession: NC_017933
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 117219 - 118010 bp
Length : 792 bp
Strand : +
Note : COG0745;K02483

DNA sequence :
GTGCTTATCCTGCCACCCGCGCGGGCGAAAACGCCTGACGCGAAGATGACAGTTTTGTCATCCTGCGCATCGCTGCTGGG
CAGCGCCCGCGTTCTTTGCGAGACTGTCGCCATGAAACTGCTGCTGATTGAAGACAACGACAAAACCCGCGCGTGGCTCG
AAAAAGGGCTGCGGGAGGCGGGGCTGGTGGTGGACGCCGTCGCCGACGGGCGCGATGGCCTGCACCTGGCGCTGGAGCAA
GACTACGCGCTGATCATCCTCGATATCATGCTGCCGGGCCTCGACGGCTGGCAGGTGTTGCGCGCGCTGCGCACCGCCAA
AGCCACGCCGGTGCTCTGCCTGACGGCCAGAGATGCGGTAAGCGATCGCGTGAAAGGGCTGGAGCTGGGGGCCGATGATT
ATCTGGTGAAGCCCTTTTCCTTCGCCGAACTGCTGGCGCGCGTGCGGGCGCAACTGCGCCGCCATGCGCCTGCCGCCGCG
ACGCTACAGGTGGCGGATCTGACGCTTGATACCGCGCGTCACGCCGCCAGCCGCGGCGGCGAGCGCATCGCGCTGACCCG
CCAGGAATTTACGCTGCTGTGGCTGCTGGCAAGCCGCGTCGGGGAAATTTTGCCGCGCACGCTGATTGCCAGCGAAGTCT
GGGGGATTAACTTTGACAGCGAAACCAACGTGGTGGATGTCGCCATCCGTCGCCTGCGCAAAAAAATCGACGATCCGTTC
CCGCTCAAGCTGATAGAAACCGTGCGCGGCATGGGTTATCGCCTTAACGCGCCGGAGCAGAGCGATGCGTAG

Protein sequence :
MLILPPARAKTPDAKMTVLSSCASLLGSARVLCETVAMKLLLIEDNDKTRAWLEKGLREAGLVVDAVADGRDGLHLALEQ
DYALIILDIMLPGLDGWQVLRALRTAKATPVLCLTARDAVSDRVKGLELGADDYLVKPFSFAELLARVRAQLRRHAPAAA
TLQVADLTLDTARHAASRGGERIALTRQEFTLLWLLASRVGEILPRTLIASEVWGINFDSETNVVDVAIRRLRKKIDDPF
PLKLIETVRGMGYRLNAPEQSDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-77 73
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-78 67

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0197 Protein 3e-62 61
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0083 Protein 3e-62 60
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0125 Protein 4e-62 60
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0111 Protein 3e-61 59
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0308 Protein 3e-56 57
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0638 Protein 3e-56 57
yedW YP_006341190.1 transcriptional regulatory protein YedW BAC0347 Protein 2e-55 54
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 4e-41 45
yedW YP_006341190.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 2e-35 43
yedW YP_006341190.1 transcriptional regulatory protein YedW NC_012469.1.7685629. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_006341190.1 transcriptional regulatory protein YedW VFG0596 Protein 9e-78 73
yedW YP_006341190.1 transcriptional regulatory protein YedW VFG1389 Protein 3e-34 45
yedW YP_006341190.1 transcriptional regulatory protein YedW VFG1390 Protein 8e-38 43
yedW YP_006341190.1 transcriptional regulatory protein YedW VFG0473 Protein 7e-32 41