Gene Information

Name : Mrub_1103 (Mrub_1103)
Accession : YP_003506887.1
Strain : Meiothermus ruber DSM 1279
Genome accession: NC_013946
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1108260 - 1108943 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; InterPro IPR001789:IPR001867:IPR005829; KEGG: bsu:BSU13250 hypothetical protein; COGs: COG0745 Response regulators consisting of a CheY-like r

DNA sequence :
ATGGAAAGCATGGATCAACCCCTGATCCTGATCGTCGAAGACGAAAAGGATATCGCCCGCTTTATTGAGCTCGAGCTTCA
GGCCGAGGGCTACCGTACCGAGGTGGCCTACGACGGCATCACCGGCCTATCGCGCTTTCGTGAGACCAACCCCAACCTGG
TGGTGATGGACCTGATGCTACCAGTCATGGACGGCCTCGAGGTGGCCCGCCGGATTCGCAAGACCTCCAATGTACCGATC
GTTATCCTGACCGCCAAAGACCGGGTCGAAGACAAGGTGGAGGGCCTGGATGCCGGCGCCGACGACTACCTGGTGAAGCC
CTTCAGCATCGAGGAGCTGCTGGCCCGCATCCGCGCCCACCTGCGCCGGGTAACCCCCGCCATTACCGGCGAAATTCGGG
TCTCCGACCTGATCATCAACCTCGAGGGCCGCGAGGTATACCGTTCAGGCCGGCGCATCGAGTTCTCCAACAAGGAGTTC
GAGCTCCTGGAGTTGCTGGCCAAGAGCCCCGGCAAGGTGTTCAGCCGCTTCGAAATCGAGGAAAAGGTCTGGCCCGGCTA
CCAGGGCGGCTCCAACGTGGTCGATGTGTACATCGGCTACTTGCGGAAGAAGCTCGAGGGCGCCGGTGAGCGCCGCCTGA
TACACACCGTGCGGGGTGTGGGCTACGTGTTACGGGAAGACTGA

Protein sequence :
MESMDQPLILIVEDEKDIARFIELELQAEGYRTEVAYDGITGLSRFRETNPNLVVMDLMLPVMDGLEVARRIRKTSNVPI
VILTAKDRVEDKVEGLDAGADDYLVKPFSIEELLARIRAHLRRVTPAITGEIRVSDLIINLEGREVYRSGRRIEFSNKEF
ELLELLAKSPGKVFSRFEIEEKVWPGYQGGSNVVDVYIGYLRKKLEGAGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-38 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-44 50
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-39 49
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-39 49
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-43 46
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-35 44
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-36 43
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-32 43
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-40 42
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-37 42
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-34 42
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-33 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-39 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-35 41
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 9e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-49 49
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-40 43
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-38 42
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator VFG1563 Protein 9e-32 42
Mrub_1103 YP_003506887.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-31 41