Gene Information

Name : STMDT12_C11150 (STMDT12_C11150)
Accession : YP_005246811.1
Strain : Salmonella enterica T000240
Genome accession: NC_016860
Putative virulence/resistance : Virulence
Product : transcriptional regulator YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1181322 - 1182002 bp
Length : 681 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAAGCAGGCTATGTGGT
TGATTATGCCTGTGATGGACGAGACGGATTACACCTGGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCATGTCCCTGCCTTTACTCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCAGTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGAGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACAC
CGTTGATGTCGCGATTCGTCGGCTGCGCGCCAAAGTAGACGATCCATTTGAAAAGAAGCTCATTATGACCGTCCGGGGGA
TGGGTTATCGATTACAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAHQSPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPAFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFEKKLIMTVRGMGYRLQAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-103 100
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-102 98

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0197 Protein 1e-59 58
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0083 Protein 1e-55 57
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0125 Protein 6e-60 56
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0638 Protein 9e-53 56
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0308 Protein 2e-54 55
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0111 Protein 1e-56 53
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW BAC0347 Protein 4e-50 52
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_007793.3914065.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_007622.3794948.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_002951.3238224.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_002952.2859858.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_013450.8614146.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_010079.5776364.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_003923.1003417.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW NC_002758.1121390.p0 Protein 6e-40 45
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW AE015929.1.gene1106. Protein 3e-34 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW VFG0596 Protein 6e-104 100
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW VFG0473 Protein 6e-30 42
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW VFG1389 Protein 3e-32 42
STMDT12_C11150 YP_005246811.1 transcriptional regulator YedW VFG1390 Protein 4e-38 41