Gene Information

Name : SeD_A1164 (SeD_A1164)
Accession : YP_002215020.1
Strain : Salmonella enterica CT_02021853
Genome accession: NC_011205
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG1357
EC number : -
Position : 1154947 - 1155822 bp
Length : 876 bp
Strand : -
Note : identified by match to protein family HMM PF00805

DNA sequence :
ATGCCAATAACTAACGCGTCCCCAGAAAATATATTAAGATATTTGCATGCGGCCGGTACCGGTACGAAAGAAGCAATGAA
AAGTGCAACTTCACCACGCGGTATACTGGAATGGTTTGTCAATTTTTTTACCTGTGGTGGAGTAAGAAGAAGCAATGAAA
GATGCTTTCGGGAGGTAATTGGAAAACTGACCACATCATTATTATATGTAAATAAAGATGCTTTCTTCGATGGTAATAAA
ATATTTCTGGAGGATGTCAACGGGTGTACTATATGTCTGTCATGTGGAGCAGCATCCGAAAATACGGCTCCCATGGTCAT
TATTGAAGTGAACAAAAATGGAAAAACTGTAACGGATAAAGTTGATAGCGAGAGATTTTGGAATGTATGTCGAATGTTAA
AACTGATGAGTCAACATAATATACAACAGCCTGATTCACTTATAACCGAGGATGGTTTTCTGAACCTGCGCGGAGTAAAC
CTGGCTCATAAAGATTTCCAGGGGGAAGATTTGTCAGACATAGATGCTTCTGATGCAGATTTCCGTGAAACAAATCTATC
TAATGTAAATTTAGTCGGTGCAAATTTGTGTTGTGCAAATCTACACGCTGTAAATCTAATGGGTTCAAACATGACTAAAG
CAAACCTGACTCACGCAGACCTGACTTGCGCTAACATGTCCGGTGTAAACTTAACCGCTGCAATTCTATTCGGCTCAGAC
TTAACTGACACCAAACTAAATGGTGCGAAATTAGATAAGATAGCTCTAACTTTAGCGAAAGCATTAACAGGAGCCGATCT
GACAGGTAGTCAACATACCCCTACTCCACTCCCGGATTACAATGATAGAACTCTTTTCCCCCATCCGATATTTTAG

Protein sequence :
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERCFREVIGKLTTSLLYVNKDAFFDGNK
IFLEDVNGCTICLSCGAASENTAPMVIIEVNKNGKTVTDKVDSERFWNVCRMLKLMSQHNIQQPDSLITEDGFLNLRGVN
LAHKDFQGEDLSDIDASDADFRETNLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHADLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKALTGADLTGSQHTPTPLPDYNDRTLFPHPIF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pipB AAC33725.1 PipB Virulence SPI-5 Protein 6e-132 99
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 Virulence SPI-5 Protein 5e-130 99
pipB NP_460061.1 secreted effector protein Virulence SPI-5 Protein 2e-129 98
pipB NP_455586.1 conserved hypothetical protein Virulence SPI-5 Protein 1e-130 98

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SeD_A1164 YP_002215020.1 hypothetical protein VFG0589 Protein 8e-130 98