Gene Information

Name : SeD_A1170 (SeD_A1170)
Accession : YP_002215026.1
Strain : Salmonella enterica CT_02021853
Genome accession: NC_011205
Putative virulence/resistance : Virulence
Product : heavy metal sensor kinase family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 1160777 - 1162141 bp
Length : 1365 bp
Strand : -
Note : identified by match to protein family HMM PF00512; match to protein family HMM PF00672; match to protein family HMM PF02518; match to protein family HMM TIGR01386

DNA sequence :
ATGGTTAAGTTATCAATGACGCTGCGCCTGACAATTTCTTTTATCGCCATCCTTATCCTCGCCTGTACCGGCATTAGCTG
GACGCTCTATAACGCGCTGAGCAAAGAATTAACGTATCGTGATGATATGACGCTAATAAATCGGGCGGCGCAAATGCAGC
AACTGTTACTGGATGGCGCCAGGCCGGAAAATCTGCCGCTCTATTTCAATCGGATGGTGGATACGAAGCAGGATATCTTA
TTGATCCATTCAGCAACAGGCCACAATGTTGCGATTAATCATAGCGGCATCCCCGACCAACGCTTTAACGAGATTCCGCT
GGCTAAAAACATCACCCGCGAAACCTTATTTCGCCAGGCGGTACAAGGCACGGAACTTACCGCGGTACGAGTAAACGCCA
GAAGCGGCGATGACCCGCTGACCCTTACTATTGCCAGGCTGGCGACGGAAAGGCGGCAAATGCTGACGCAATATCGCCGC
AACAGTTTGCTGATTAGCCTTATCGCGATCCTCGTCTGTTCGGCGCTCAGTCCATTAGTCATCAGAAACGGGCTGCGGGC
CATTACGTCGCTCAGCCGACTCACCGCGGCGACAGATAGCGGCACACTTCGCCAGCCGTTGGCGGAACAGGCGTTACCCG
TTGAGCTCAGGCCGCTTGGACAAGCGCTAAATACCATGCGCCAGAAGCTTTCCGACGATTTTGAACGCCTGAACCAATTT
GCCGACGATCTGGCGCATGAGCTGCGCACGCCGGTTAATATTTTACTGGGGAAGAATCAGGTGATGCTGAGTCAGGAACG
CAGCGCCGAAGAGTATCAACAAGCCCTTGTCGATAATATTGAAGAGCTGGAGGGACTGTCGCGACTGACAGAAAATATTC
TCTTTCTGGCACGCGCGGAGCACCAGAATATAGCGGTAAAAAAACAGCCTGTTTCGCTCAATGCGCTGGTCGAAAATATG
CTGGATTATCTTAGCCCCCTTGCCGAGGAGAAGCGCATCTGTTTTATAAATCAATGTCAGGGAACGGTATGGGCTGACGA
AATATTATTACAAAGAGTGCTCTCAAACCTGCTGACGAATGCCATCCGTTATTCTGATGAAAACGCCGTGATACGTATTG
AAAGCGCTTATGATGATAACGTTGCAGAAATTCGGGTCGCTAATCCGGGCAGCCACCCAGCCGATGCGGATAAGCTTTTC
CGGCGTTTTTGGCGAGGAGATAATGCCCGCCACACTGCCGGTTTCGGCCTGGGGTTATCGTTAGTTAACGCGATTGCTCT
ATTACACGGTGGTTCGGCATCTTACCGCTATGCCGATGAACATAATATCTTTTCGGTTCGTCTGCCCGATAGCGGTGATA
GCTAA

Protein sequence :
MVKLSMTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENLPLYFNRMVDTKQDIL
LIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTELTAVRVNARSGDDPLTLTIARLATERRQMLTQYRR
NSLLISLIAILVCSALSPLVIRNGLRAITSLSRLTAATDSGTLRQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQF
ADDLAHELRTPVNILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIAVKKQPVSLNALVENM
LDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYSDENAVIRIESAYDDNVAEIRVANPGSHPADADKLF
RRFWRGDNARHTAGFGLGLSLVNAIALLHGGSASYRYADEHNIFSVRLPDSGDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 0.0 99
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 0.0 99

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SeD_A1170 YP_002215026.1 heavy metal sensor kinase family protein VFG0595 Protein 0.0 99