Gene Information

Name : Pmen_1174 (Pmen_1174)
Accession : YP_001186671.1
Strain : Pseudomonas mendocina ymp
Genome accession: NC_009439
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1322346 - 1323020 bp
Length : 675 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCGAATCCTGATTGTTGAGGACGAGCTTAAAACTGCCGAATATCTCCACCAGGGACTTACCGAGAGCGGCTATGTCGT
CGATATTGCCACCAATGGTGTCGACGGCTTGCACATGGCGGCCCAAGCGTCCTACGAATTGATCATCCTTGATGTCGACT
TACCAGAGATCGATGGCTGGGGCGTACTGGCCAGCATTCGCCGTAATAGTCGCACCCCTGTGATGATGCTGACGGCACGC
GGGCGCCTGGCCGACAAGCTCAAAGGTTTCGACTCCGGTGCCGACGACTATCTGGTGAAGCCATTCGAGTTCCCCGAGCT
TCTGGCCAGAGTTCGCTCGCTGCTACGAAGAGGTGAACAGGTCAGCGCGCCAGACGTGCTCAAGGTCGACGACCTTGAGC
TGGATCCAGCCCGCCACCGCGCCTATCGCAATGGTCAACGAATCGATCTGACCACCAAGGAGTTCGCTCTGCTGCACCTG
CTGATGCGACGCAGCGGCGAAGTACTCTCGCGCACCCAGATCATCTCGCTGGTCTGGGACATGAACTTCGACTGTGATAC
CAACGTCGTCGAAGTTTCCATCCGGCGCTTGCGCGCCAAGATCGACGACCCTTTCGAGAACAAACTGATCCACACCTTGC
GCGGCGTCGGCTATGTACTGGAGGCTCGTCAATGA

Protein sequence :
MRILIVEDELKTAEYLHQGLTESGYVVDIATNGVDGLHMAAQASYELIILDVDLPEIDGWGVLASIRRNSRTPVMMLTAR
GRLADKLKGFDSGADDYLVKPFEFPELLARVRSLLRRGEQVSAPDVLKVDDLELDPARHRAYRNGQRIDLTTKEFALLHL
LMRRSGEVLSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFENKLIHTLRGVGYVLEARQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-59 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-58 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-67 62
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0197 Protein 6e-66 62
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0638 Protein 5e-56 58
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0083 Protein 9e-61 57
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-60 57
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-62 54
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-57 52
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-39 45
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-34 44
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-33 42
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator Y16952.3.orf35.gene. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-59 56
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator VFG1390 Protein 5e-39 43
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator VFG1386 Protein 1e-35 43
Pmen_1174 YP_001186671.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-37 43