Gene Information

Name : pipB (SC1040)
Accession : YP_216027.1
Strain : Salmonella enterica SC-B67
Genome accession: NC_006905
Putative virulence/resistance : Virulence
Product : pathogenicity island encoded protein: SPI3
Function : -
COG functional category : S : Function unknown
COG ID : COG1357
EC number : -
Position : 1157062 - 1157937 bp
Length : 876 bp
Strand : -
Note : IPR000169: Eukaryotic thiol (cysteine) protease

DNA sequence :
ATGCCAATAACTAACGCGTCCCCAGAAAATATATTAAGATATTTGCATGCGGCCGGTACCGGTACGAAAGAAGCAATGAA
AAGTGCAACTTCACCACGCGGTATACTGGAATGGTTTGTCAATTTTTTTACCTGTGGTGGAGTAAGAAGAAGCAATGAAA
GATGGTTTCGGGAGGTAATTGGAAAACTGACCACATCATTATTATATGTAAATAAAAATGCTTTCTTCGATGGTAATAAA
ATATTTCTGGAGGATGTCAACGGGTGTACTATATGTCTGTCATGTGGAGCAGCATCCGAAAATACGGATCCCATGGTCAT
TATTGAAGTGAACAAAAATGGAAAAACTGTAACGGATAAAGTTGATAGTGAGAGATTTTGGAATGTATGTCGAATGTTAA
AACTGATGAGTAAACATAATATACAACAGCCTGATTCACTTATAACCGAGGATGGTTTTCTGAACCTGCGCGGAGTAAAC
CTGGCTCATAAAGATTTCCAGGGGGAAGATTTGTCAGACATAGATGCTTCTGATGCAGATTTCCGTGAAACAAATCTATC
TAATGTAAATTTAGTCGGTGCAAATTTGTGTTGTGCAAATCTACACGCTGTAAATCTAATGGGTTCAAACATGACTAAAG
CAAACCTGACTCACGCAGACCTGACTTGCGCTAACATGTCCGGTGTAAACTTAACCGCTGCAATTCTATTCGGCTCAGAC
TTAACTGACACCAAACTAAATGGTGCGAAATTAGATAAGATAGCTCTAACTTTAGCGAAATCATTAACAGGAGCCGATCT
GACAGGTAGTCAACATACCCCTACTCCACTCCCGGATTACAATGATAGAACTCTTTTCCCCCATCCGATATTTTAG

Protein sequence :
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERWFREVIGKLTTSLLYVNKNAFFDGNK
IFLEDVNGCTICLSCGAASENTDPMVIIEVNKNGKTVTDKVDSERFWNVCRMLKLMSKHNIQQPDSLITEDGFLNLRGVN
LAHKDFQGEDLSDIDASDADFRETNLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHADLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKSLTGADLTGSQHTPTPLPDYNDRTLFPHPIF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 Virulence SPI-5 Protein 1e-132 100
pipB NP_460061.1 secreted effector protein Virulence SPI-5 Protein 6e-132 99
pipB AAC33725.1 PipB Virulence SPI-5 Protein 5e-129 98
pipB NP_455586.1 conserved hypothetical protein Virulence SPI-5 Protein 4e-128 98

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 VFG0589 Protein 3e-132 99