Gene Information

Name : CFSAN001992_06170 (CFSAN001992_06170)
Accession : YP_007470990.1
Strain : Salmonella enterica CFSAN001992
Genome accession: NC_020307
Putative virulence/resistance : Virulence
Product : heavy metal sensor kinase family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1189099 - 1190463 bp
Length : 1365 bp
Strand : +
Note : COG0642 Signal transduction histidine kinase

DNA sequence :
ATGGTTAAGTTATCAATGACGCTGCGCCTGACAATTTCTTTTATCGCCATACTTATCCTCGCCTGTACCGGCATTAGCTG
GACGCTCTATAACGCGCTGAGCAAAGAATTAACGTATCGGGATGATATGACGCTAATAAATCGGGCGGCGCAAATGCAGC
AACTGTTACTGGATGGCGCCAGGCCGGAAAATCTGCCGCTCTATTTCAATCGGATGGTGGATACGAAGCAGGATATCTTA
TTGATCCATTCAGCAACAGGCCACAATGTTGCGATTAATCATAGCGGCATCCCCGACCAACGCTTTAACGAGATTCCGCT
GGCTAAAAACATCACCCGCGAAACCTTATTTCGCCAGGCGGTACAAGGCACGGAGCTGACCGCGGTACGAGTAAACGCCA
GAAGCGGCGATGACCCGCTGACCCTTACTATTGCCAGGCTGGCGACGGAAAGGCGGCAAATGCTGACGCAATATCGCCGC
AACAGTTTGCTGATTAGCCTTATCGCGATCCTCGTCTGTTCGGCGCTCAGTCCATTAGTCATCAGAAACGGGCTGCGGGC
CATTACGTCGCTCAGCCGACTCACCGCGGCGACAGATAGCGGCACACTTCGCCAGCCGCTGGCGGAACAGGCGTTACCCG
TCGAGCTCAGGCCGCTTGGACAAGCGCTAAATACCATGCGCCAGAAGCTTTCCGACGATTTTGAACGCCTGAACCAATTT
GCTGACGATCTGGCGCATGAGCTGCGCACGCCGATTAATATTTTACTGGGGAAGAATCAGGTGATGCTGAGTCAGGAACG
CAGCGCCGAAGAGTATCAACAAGCCCTTGTCGATAATATTGAAGAGCTGGAGGGACTGTCGCGACTAACAGAAAATATTC
TCTTTCTGGCACGCGCGGAGCACCAGAATATAGCGGTAAAAAAACAGCCTGTTTCGCTCAATGCGCTGGTCGAAAATATG
CTGGATTATCTTAGCCCCCTTGCCGAGGAGAAGCGCATCTGTTTTATAAATCAATGTCAGGGAACGGTATGGGCTGACGA
AATATTATTACAAAGAGTGCTCTCAAACCTGCTGACGAATGCCATCCGTTATTCTGATGAAAACGCCGTGATACGTATTG
AAAGCGCTTATGATGATAACGTTGCAGAAATTCGGGTCGCTAATCCGGGCAGCCACCCCGCCGATGCGGATAAGCTTTTC
CGGCGTTTTTGGCGAGGAGATAATGCCCGCCACACTGCCGGTTTCGGCCTGGGGTTATCGTTAGTTAACGCGATTGCTCT
ATTACACGGTGGTTCGGCATCTTACCGCTATGCCGATGAACATAATATCTTTTCGGTTCGTCTGCCTGATAGCGGTGATA
GCTAA

Protein sequence :
MVKLSMTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENLPLYFNRMVDTKQDIL
LIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTELTAVRVNARSGDDPLTLTIARLATERRQMLTQYRR
NSLLISLIAILVCSALSPLVIRNGLRAITSLSRLTAATDSGTLRQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQF
ADDLAHELRTPINILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIAVKKQPVSLNALVENM
LDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYSDENAVIRIESAYDDNVAEIRVANPGSHPADADKLF
RRFWRGDNARHTAGFGLGLSLVNAIALLHGGSASYRYADEHNIFSVRLPDSGDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 0.0 99
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 0.0 99

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFSAN001992_06170 YP_007470990.1 heavy metal sensor kinase family protein VFG0595 Protein 0.0 99