Gene Information

Name : copS (SC1045)
Accession : YP_216032.1
Strain : Salmonella enterica SC-B67
Genome accession: NC_006905
Putative virulence/resistance : Virulence
Product : copper resistance; histidine kinase
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 1161704 - 1163068 bp
Length : 1365 bp
Strand : -
Note : IPR003660: Histidine kinase, HAMP region; IPR005467: Histidine kinase

DNA sequence :
ATGGTTAAGTTATCAATGACGCTGCGCCTGACAATTTCTTTTATCGCCATCCTTATCCTCGCCTGTACCGGCATTAGCTG
GACGCTCTATAACGCGTTGAGCAAAGAATTAACGTATCGGGATGATATGACGCTAATAAATCGGGCGGCGCAAATGCAGC
AACTGTTACTGGATGGCGCCAGGCCGGAAAATCTGCCGCTCTATTTCAATCGGATGGTGGATACGAAGCAGGATATCTTA
TTGATCCATTCAGCAACAGGCCACAATGTTGCGATTAATCATAGCGGCATCCCCGACCAACGCTTTAACGAGATTCCGCT
GGCTAAAAACATCACCCGCGAAACCTTATTTCGCCAGGCGGTACAAGGCACGGAACTTACCGCGGTACGAGTAAACGCCA
GAAGCGGCGATGACCCGCTGACCCTTACTATTGCCAGGCTGGCGACGGAAAGGCGGCAAATGCTGGCGCAATATCGCCGT
AACAGTTTGCTGATTAGCCTTATCGCGATCCTCGTCTGTTCGGCGCTCAGTCCATTAGTCATCAGAAACGGGCTGCGGGC
CATTACGTCGCTCAGCCGACTCACCGCGGCGACAGATAGCGGCACACTTCGCCAGCCGTTGGCGGAACAGGCGTTACCCG
TCGAGCTCAGGCCGCTTGGACAAGCGCTAAATACTATGCGCCAGAAGCTTTCCGACGATTTTGAACGCCTGAACCAATTT
GCCGACGATCTGGCGCATGAGCTGCGCACGCCGGTTAATATTTTACTGGGGAAGAATCAGGTGATGCTGAGTCAGGAACG
CAGCGCCGAAGAGTATCAACAAGCCCTTGTCGATAATATTGAAGAGCTGGAGGGACTGTCGCGACTGACAGAAAATATTC
TCTTTCTGGCACGCGCGGAGCACCAGAATATAGCGGTAAAAAAACAGCCTGTTTCGCTCAATGCGCTGGTCGAAAATATG
CTGGATTATCTTAGCCCCCTTGCCGAGGAGAAGCGCATCTGTTTTATAAATCAATGTCAGGGAACGGTATGGGCTGACGA
AATATTATTACAAAGAGTGCTCTCAAACCTGCTGACGAATGCCATCCGTTATTCTGATGAAAACGCCGTGATACGTATTG
AAAGCGCTTATGATGATAACGTTGCAGAAATTCGGGTCGCTAATCCGGGCAGCCACCCCGCCGATGCGGATAAGCTTTTC
CGGCGTTTTTGGCGAGGAGATAATGCCCGCCACACTGCCGGTTTCGGCCTGGGGTTATCGTTAGTTAACGCGATTGCTCT
ATTACACGGTGGTTCGGCATCTTACCGCTATGCCGATGAACATAATATCTTTTCGGTTCGTCTGCCCGATAGCGGTGATA
GCTAA

Protein sequence :
MVKLSMTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENLPLYFNRMVDTKQDIL
LIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTELTAVRVNARSGDDPLTLTIARLATERRQMLAQYRR
NSLLISLIAILVCSALSPLVIRNGLRAITSLSRLTAATDSGTLRQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQF
ADDLAHELRTPVNILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIAVKKQPVSLNALVENM
LDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYSDENAVIRIESAYDDNVAEIRVANPGSHPADADKLF
RRFWRGDNARHTAGFGLGLSLVNAIALLHGGSASYRYADEHNIFSVRLPDSGDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 0.0 99
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 0.0 99

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copS YP_216032.1 copper resistance; histidine kinase VFG0595 Protein 0.0 99