Gene Information

Name : Ajs_1236 (Ajs_1236)
Accession : YP_985538.1
Strain : Acidovorax sp. JS42
Genome accession: NC_008782
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1314511 - 1315170 bp
Length : 660 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: net:Neut_0018 two component heavy metal response transcriptional regulator, winged helix family protein

DNA sequence :
ATGAAACTGCTGGTCGTTGAAGACGAGAACAAGACGGCGGATTACGTCCGCCAAGGTCTCATGGAGGCGGGATTCGTCGT
GGATCTGGCGCGCAACGGATTGGACGGACACCACCTGGCCATGGGCGAGACATACGATCTGGTGGTCTTGGATGTCATGC
TGCCGGATGTCGATGGCTGGCGCATCGTGCGTGCCCTTCGAGATGCCGGTAAACAGGTCCCTGTGCTCTTTCTGACGGCG
CGTGGCGGTGTAGACGACCGTGTCAAGGGATTGGAACTGGGAGCGGACGACTACCTCGTCAAGCCATTCGCGTTCTCTGA
GTTGCTGGCGCGGGTGCGGACGCTGCTGCGACGCGGAAGCGCTCCGAGCCAGCCTGATCGCATCCAGGTTGCCGATTTGG
TGCTGGACTTGGCGCGCCGGCGCGCAACGCGCGCTGGCCAACGCATCAATCTCACCAGCAAGGAGTTCGCGTTGCTTGAG
CTCCTGGCCCGTCGCCACGGGGAGGTCCTTCCACGTTCTCTGATCGCGTCGCAGGTATGGGACATGAATTTCGACAGCGA
TAGCAACGTCATCGATGTAGCCATCCGCCGTCTCCGCGCGAAGATAGACGATGCGTTCAATCCGAAGCTCATTCACACCG
TGCGTGGAATGGGATACTGA

Protein sequence :
MKLLVVEDENKTADYVRQGLMEAGFVVDLARNGLDGHHLAMGETYDLVVLDVMLPDVDGWRIVRALRDAGKQVPVLFLTA
RGGVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSAPSQPDRIQVADLVLDLARRRATRAGQRINLTSKEFALLE
LLARRHGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFNPKLIHTVRGMGY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-53 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-52 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-66 72
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-69 71
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-57 68
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-60 65
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-59 65
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0308 Protein 5e-59 62
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0125 Protein 5e-58 61
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 1e-27 44
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator BAC0487 Protein 5e-25 42
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-29 41
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator VFG0596 Protein 5e-54 59
Ajs_1236 YP_985538.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-37 44