Gene Information

Name : irlR (ABBFA_001250)
Accession : YP_002325153.1
Strain : Acinetobacter baumannii AB307-0294
Genome accession: NC_011595
Putative virulence/resistance : Virulence
Product : transcriptional activator protein irlR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1346813 - 1347484 bp
Length : 672 bp
Strand : +
Note : [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGTATTCTTATTATTGAAGACGAGATCAAAATCGCCACTTATTTGGTCAAAGGGTTAAAAGAATCCGGATACCAAGC
CGAGTGCGTACATTTAGGACTTCAAGGTTTGGAAATGCTAAAAAGAGATCAATATGACTTGCTTATTCTTGATGTGATGT
TGCCGGACATAGAGGGCTGGAGCGTACTACAGGTACTACGCCAGTTTTCAAAAATTCCGGTGATTTTCTTAACGGCAAAA
GATCAGGTCATGGATAGAGTGAAAGGGTTAGAGTTAGGTGCAGATGACTACTTGGCTAAACCCTTTTCCTATATTGAACT
CTTGGCACGCATTAAAAGTTTGTTAAGACGACAGCAGTATTTGCAAGAAAATGAGTTGTCTATAAGTGATCTAAAAATGG
ATTTGGTGGGGCATAAAGTATGGCGTAATGGCAACTTAATCGAACTGAGTAAAACCGAATTTAACTTATTACGTTATTTA
TTGGTCAATAAAGAACAAATCGTGACGCGTAGACAAATCGGTTCTGAGGTTTGGAATATTAACTTTGACACCGATACCAA
CTTTATTGACGTTGCAGTACGCCGTTTAAGAAGCAAAATTGATGAAGGATATGAACCAAAACTTATCCATACCATCCGTG
GCTTGGGCTATAAAATTTCGGTTAGCTTATGA

Protein sequence :
MRILIIEDEIKIATYLVKGLKESGYQAECVHLGLQGLEMLKRDQYDLLILDVMLPDIEGWSVLQVLRQFSKIPVIFLTAK
DQVMDRVKGLELGADDYLAKPFSYIELLARIKSLLRRQQYLQENELSISDLKMDLVGHKVWRNGNLIELSKTEFNLLRYL
LVNKEQIVTRRQIGSEVWNINFDTDTNFIDVAVRRLRSKIDEGYEPKLIHTIRGLGYKISVSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-49 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-48 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_002325153.1 transcriptional activator protein irlR BAC0308 Protein 1e-52 54
irlR YP_002325153.1 transcriptional activator protein irlR BAC0197 Protein 2e-58 54
irlR YP_002325153.1 transcriptional activator protein irlR BAC0125 Protein 6e-57 52
irlR YP_002325153.1 transcriptional activator protein irlR BAC0111 Protein 5e-56 50
irlR YP_002325153.1 transcriptional activator protein irlR BAC0083 Protein 7e-54 50
irlR YP_002325153.1 transcriptional activator protein irlR BAC0638 Protein 1e-49 50
irlR YP_002325153.1 transcriptional activator protein irlR BAC0347 Protein 1e-51 48
irlR YP_002325153.1 transcriptional activator protein irlR NC_007793.3914065.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_007622.3794948.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_002951.3238224.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_002952.2859858.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_013450.8614146.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_010079.5776364.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_003923.1003417.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR NC_002758.1121390.p0 Protein 2e-34 44
irlR YP_002325153.1 transcriptional activator protein irlR AE015929.1.gene1106. Protein 2e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_002325153.1 transcriptional activator protein irlR VFG0596 Protein 5e-50 50
irlR YP_002325153.1 transcriptional activator protein irlR VFG1390 Protein 3e-38 43