Gene Information

Name : Clopa_1269 (Clopa_1269)
Accession : YP_007939934.1
Strain : Clostridium pasteurianum BC1
Genome accession: NC_021182
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1311302 - 1311985 bp
Length : 684 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGAAAGCTTTCAAGATACTCATAGTGGAAGATGAAAAACAGATGGCTATGTTTATTGAAATGGAATTAACTCATGAGGG
ATATAAGGCGGATGTTTCTCATGATGGTATAGATGCACTTAAAAAAATTGAGAAAAACAGATATGATTTGATTATTCTTG
ATATAATGCTGCCTGGTTTAAATGGAATGGAAGTTTGTAGAGAAGTTAGAGGCAGCTACAATATACCCATTATAATGCTT
ACAGCCAAAAGTGATGTAAGTGATAAAGTTAAAGGACTAGATATTGGGGCAAATGATTATATGACCAAGCCTTTTGCAAT
AGAGGAACTATTAGCCAGAATAAGAGTAATAGAGAGAAATAATATATCATCAAGCTGTAAATATGATGAAATAAAATTTA
AGGATATAGTAATGAATAATAGTACACATCAAGTATTAAGAAATGGTAAAAAAATTGATTTGACAAAGAAGGAATATGAT
TTATTAGAAACTTTACTTATAAATAAAAATATAGTTCTTACCAGAGAGCAGCTAATTGAAAAAATATGGGGCTACGATTA
TGAGGGTGACACAAATGTAGTAGATGTTTTTATAAGATACTTGAGGAGCAAAATAGATGATGATTTTGAAAATAAAATTA
TTACTACTGTTAGAGGGGTAGGATATGTAATTAATGAAAATTAA

Protein sequence :
MKAFKILIVEDEKQMAMFIEMELTHEGYKADVSHDGIDALKKIEKNRYDLIILDIMLPGLNGMEVCREVRGSYNIPIIML
TAKSDVSDKVKGLDIGANDYMTKPFAIEELLARIRVIERNNISSSCKYDEIKFKDIVMNNSTHQVLRNGKKIDLTKKEYD
LLETLLINKNIVLTREQLIEKIWGYDYEGDTNVVDVFIRYLRSKIDDDFENKIITTVRGVGYVINEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-43 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-43 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 7e-50 55
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 2e-48 54
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 3e-47 52
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 9e-46 46
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain FJ349556.1.orf0.gene Protein 4e-35 43
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 8e-41 43
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 3e-42 43
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 9e-38 43
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 2e-46 42
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-36 42
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain DQ212986.1.gene4.p01 Protein 2e-33 41
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_014475.1.orf0.gen Protein 4e-32 41
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_005054.2598277.p0 Protein 4e-32 41
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 9e-43 41
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 8e-38 41
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-33 41
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 5e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 7e-44 43
Clopa_1269 YP_007939934.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 1e-51 42