Gene Information

Name : Bmul_6295 (Bmul_6295)
Accession : YP_001573748.1
Strain :
Genome accession: NC_010070
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 161907 - 162578 bp
Length : 672 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bam:Bamb_5186 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATACTGATAGTCGAAGACGAACCGAAAATGGCGTCATATCTCCGAAAGGGACTGACGGAAGCGAGCTATACCGT
CGATGTTGCCGAGAACGGCAAAATCGGATTGTTTCTCGCGCTGCATGAAAATTTTGACCTCGTCGTGCTCGACGTCATGC
TCCCGGAGCTGGACGGGTTCGAGGTGCTGAAGCGCCTCCGCGCGGAAAAGCAGACACCCGTGCTGATGCTGACCGCCCGC
GAAGCAATCGAGGACAAGGTCGCTGGGCTTGAACTTGGTGCAGACGACTATCTACACAAACCGTTCGCCTACGCGGAATT
TCTCGCACGCATCCGTTCGTTGCTACGGCGCGCACCGCGGAGCATTCGGGACATTCTGCTCGTTGCGGACATGGAGATTG
ACCTCCTCAAGCGGCGAGTGCGTCGCGGCGACAATCGCATCGACCTGACCGCACAGGAGTTCGCATTGTTGCAACTCCTG
GCTGAACGAGAGGGCGAGGTTTTGACGCGTACTTTCATTACCTCGCAGATCTGGGATATGAATTTCGATAGCGATACGAA
CGTGGTCGATGCCGCGATCAAGCGCCTGCGCGCCAAAGTCGACAACGCGTACGATAAGAAACTGATCCATACCATCCGGG
GCATGGGATACGTGCTCGAGGACCGTTCATGA

Protein sequence :
MRILIVEDEPKMASYLRKGLTEASYTVDVAENGKIGLFLALHENFDLVVLDVMLPELDGFEVLKRLRAEKQTPVLMLTAR
EAIEDKVAGLELGADDYLHKPFAYAEFLARIRSLLRRAPRSIRDILLVADMEIDLLKRRVRRGDNRIDLTAQEFALLQLL
AEREGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKVDNAYDKKLIHTIRGMGYVLEDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-50 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-49 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-56 61
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0638 Protein 6e-56 60
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-56 59
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-56 57
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0111 Protein 6e-54 55
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-48 54
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator BAC0308 Protein 8e-51 54
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 8e-33 45
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 6e-29 44
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-50 53
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator VFG1390 Protein 6e-35 43
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator VFG1389 Protein 4e-28 43
Bmul_6295 YP_001573748.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-32 41