Gene Information

Name : SYO3AOP1_0130 (SYO3AOP1_0130)
Accession : YP_001930330.1
Strain : Sulfurihydrogenibium sp. YO3AOP1
Genome accession: NC_010730
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 143051 - 143725 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: gme:Gmet_3383 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAAAGTTTTAATAGTAGAAGATGATAAAAACTTATCAAAACTTATTGCAAAACGTTTAAAAGAAGAAGGATATGATGT
AGTACAAGCCTACGATGCAGAAGAGGGATTAAATTACGCCAATTATGAAAACTTTGATATAATAATTCTTGATTTGATGC
TTCCTAAAATGTCTGGATTTTATATTATAGAATCTCTTAGAAACAAAAAAATAAAAACACCTATACTTGTACTAAGTGCA
AAAGATAGTGTAGAAGACAAAGTTAAAGGATTATCCTTAGGAGCTGATGATTACTTAACAAAACCTTTTAGCTTTCCAGA
GTTGTTGGCAAGAATCCAGGCTCTTGTTAGAAGAAGTAAAGATATAGATGAAATATCAAAATTGAAATATCATGACTTGG
TTATGGATTTACTTAAAAAAGAAGTTTATAGAGGAAATAAAAAAATAGACCTTACAGCAAAAGAGTATGAACTTTTAAAA
TATCTTATGGAAAATGCTGAAAAAATAGTAACAAGAAACATGATACTTGCCAACGTTTTTGATATAGATTTTGATATAGA
GAGTAATGTGGTAGATGTTCAGATACACAGATTAAGAGACAAAATAGATAAAGGATTCGATAAAAGGTTAATTCATACGG
TCCGCGGTTTTGGTTATGTTCTTAAAGCTAACTAA

Protein sequence :
MKVLIVEDDKNLSKLIAKRLKEEGYDVVQAYDAEEGLNYANYENFDIIILDLMLPKMSGFYIIESLRNKKIKTPILVLSA
KDSVEDKVKGLSLGADDYLTKPFSFPELLARIQALVRRSKDIDEISKLKYHDLVMDLLKKEVYRGNKKIDLTAKEYELLK
YLMENAEKIVTRNMILANVFDIDFDIESNVVDVQIHRLRDKIDKGFDKRLIHTVRGFGYVLKAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-46 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-45 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-50 47
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-47 45
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-44 45
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-35 44
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-47 44
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-50 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-39 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-39 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-38 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-37 43
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-31 42
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-37 42
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-41 42
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-45 42
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-33 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-27 41
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-46 46
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-43 42
SYO3AOP1_0130 YP_001930330.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-35 41