Gene Information

Name : ykoG (C663_1364)
Accession : YP_007426513.1
Strain : Bacillus subtilis XF-1
Genome accession: NC_020244
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1395848 - 1396510 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
GTGGAAGATGAAGAAAAAATCGCCAGGGTTCTTCAGCTTGAATTGGAATATGAAGGATACAGTGTCACCATCAAACACAA
TGGCACAGAAGGTCTGGATGCGGCATTGGAAGGCGGGTATTCCTTGGTGCTTCTTGATGTCATGCTTCCGGGGCTTAGCG
GACTGGAAGTGCTGCGCCGCTTGAGAAAAACGGATCCGCAGACACCGGTCATATTATTAACGGCGCGAGACAGTATTCCT
GATAAGGTAACAGGTCTGGATATCGGTGCGAATGACTATGTCACCAAGCCGTTTGAAATCGAGGAATTGCTTGCGAGAAT
CAGGGCGGCGCTGCGACAAAATGGAACAAAAACGGAAGATATCGGCACCTTTCTTACATATGACGATTTGCGGGTGAACG
AAAAAAACCGTGAAGTGAGACGCGGAGACAAAGAGGTGGAATTAACGCCGCGGGAATTTGATTTACTCGTCTATATGCTA
AAGCATCCGCAGCAAGTGCTGACACGGGAGCAAATTCTAAGCTCGGTATGGGGATTTGATTATATCGGTGATACAAATGT
CGTGGACGTCTACATAAGATACATCAGAAAAAAACTGGACTATCCTTACGAAAAACAGCTGATCCATACGATTCGCGGGG
TCGGCTATGCCATTAAGGGGTAA

Protein sequence :
MEDEEKIARVLQLELEYEGYSVTIKHNGTEGLDAALEGGYSLVLLDVMLPGLSGLEVLRRLRKTDPQTPVILLTARDSIP
DKVTGLDIGANDYVTKPFEIEELLARIRAALRQNGTKTEDIGTFLTYDDLRVNEKNREVRRGDKEVELTPREFDLLVYML
KHPQQVLTREQILSSVWGFDYIGDTNVVDVYIRYIRKKLDYPYEKQLIHTIRGVGYAIKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-42 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-41 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_007426513.1 two-component response regulator NC_007793.3914065.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_002758.1121390.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_010079.5776364.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_002952.2859858.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_007622.3794948.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_003923.1003417.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_013450.8614146.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator NC_002951.3238224.p0 Protein 9e-45 47
ykoG YP_007426513.1 two-component response regulator HE999704.1.gene1528. Protein 1e-43 47
ykoG YP_007426513.1 two-component response regulator AE015929.1.gene1106. Protein 2e-39 45
ykoG YP_007426513.1 two-component response regulator BAC0125 Protein 2e-42 45
ykoG YP_007426513.1 two-component response regulator BAC0083 Protein 4e-44 44
ykoG YP_007426513.1 two-component response regulator BAC0308 Protein 1e-41 44
ykoG YP_007426513.1 two-component response regulator BAC0197 Protein 3e-39 43
ykoG YP_007426513.1 two-component response regulator BAC0638 Protein 8e-37 43
ykoG YP_007426513.1 two-component response regulator NC_012469.1.7686381. Protein 6e-40 42
ykoG YP_007426513.1 two-component response regulator AE016830.1.gene1681. Protein 5e-40 42
ykoG YP_007426513.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-32 41
ykoG YP_007426513.1 two-component response regulator FJ349556.1.orf0.gene Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_007426513.1 two-component response regulator VFG0596 Protein 3e-42 46
ykoG YP_007426513.1 two-component response regulator VFG1390 Protein 7e-47 44
ykoG YP_007426513.1 two-component response regulator VFG1386 Protein 2e-46 44
ykoG YP_007426513.1 two-component response regulator VFG1389 Protein 2e-41 42