Gene Information

Name : CAP2UW1_4708 (CAP2UW1_4708)
Accession : YP_003165280.1
Strain :
Genome accession: NC_013193
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 140495 - 141172 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATACTGGTGGTCGAAGACGAGATCAAGACCGGGGATTACCTGCGACAAGGCCTGACCGAAGCCGGGTTCGTTGT
CGACCTGGCGCGTGATGGCCTTGATGGGTTGCATCTCGCTCAGACCGATGCCTATGACCTGGCGATACTGGATGTCATGC
TGCCCGGTATCGACGGCTGGGCGGTGTTACAGGGCATTCGCAGGGCCGGCAAGGACATGCCGGTATTGTTCCTGACGGCC
CGCGATCAGGTGCAGGATCGTGTGCACGGCCTGGAGTTAGGGGCGGACGATTACATGGTGAAGCCCTTCGCTTTCGCCGA
ACTGTTGGCGCGCGTGCGTATCCATCTGCGGCGCGGCAGCAAGACGAAGGAGTCCGAGTATCTGCGCGCAGCCGATCTAG
AACTCGACCTGATGCGGCGGCGCGTCACCCGCGCCGGCAGGCGAATCGACCTGACGGTGAAGGAGTTCGCTCTGCTCGAA
TTGCTGTTGCGACGGCAGGGCGAAGTGCTGCCGCGCTCGCTGATCGCCTCTCAGGTGTGGGACATGAACTTCGACAGTGA
CACCAACGTTATCGAGGTGGCGATCAAGCGTTTGCGGCTCAAGATCGACGAAGACTTCGAACTCAAGCTGATCCGCACCG
TTCGTGGAATGGGGTATGTGTTGGAGATCGCCGAGTGA

Protein sequence :
MKILVVEDEIKTGDYLRQGLTEAGFVVDLARDGLDGLHLAQTDAYDLAILDVMLPGIDGWAVLQGIRRAGKDMPVLFLTA
RDQVQDRVHGLELGADDYMVKPFAFAELLARVRIHLRRGSKTKESEYLRAADLELDLMRRRVTRAGRRIDLTVKEFALLE
LLLRRQGEVLPRSLIASQVWDMNFDSDTNVIEVAIKRLRLKIDEDFELKLIRTVRGMGYVLEIAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-58 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-57 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0197 Protein 1e-69 70
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0638 Protein 1e-66 69
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0083 Protein 3e-70 68
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0111 Protein 3e-71 67
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0125 Protein 4e-68 64
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0347 Protein 6e-66 63
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0308 Protein 2e-64 62
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002516.2.879194.p Protein 4e-29 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002952.2859905.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_007793.3914279.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002951.3237708.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_013450.8614421.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_009782.5559369.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_009641.5332272.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002745.1124361.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002758.1121668.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_003923.1003749.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_007622.3794472.p0 Protein 1e-31 42
CAP2UW1_4708 YP_003165280.1 hypothetical protein BAC0487 Protein 1e-27 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_007793.3914065.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_007622.3794948.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002951.3238224.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002952.2859858.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_013450.8614146.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_010079.5776364.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_003923.1003417.p0 Protein 4e-32 41
CAP2UW1_4708 YP_003165280.1 hypothetical protein NC_002758.1121390.p0 Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CAP2UW1_4708 YP_003165280.1 hypothetical protein VFG0596 Protein 3e-58 58
CAP2UW1_4708 YP_003165280.1 hypothetical protein VFG1390 Protein 2e-42 48
CAP2UW1_4708 YP_003165280.1 hypothetical protein VFG1386 Protein 1e-35 44
CAP2UW1_4708 YP_003165280.1 hypothetical protein VFG1389 Protein 8e-33 44