Gene Information

Name : Calni_0142 (Calni_0142)
Accession : YP_004050219.1
Strain : Calditerrivibrio nitroreducens DSM 19672
Genome accession: NC_014758
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 136814 - 137482 bp
Length : 669 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829: IPR001789: IPR001867; KEGG: tye:THEYE_A0752 DNA-binding response regulator; PFAM: response regulator receiver; transcrip

DNA sequence :
ATGAGAATTTTAATTGTAGAAGATGAAAAAACTTTGGCTAATTTAATAAAAAAAGGATTTGAAGAAGAAGGCTTTGCAGT
TGATATAGCCTACGACGGTGAAGATGGTCTTTTTTTCGCGCAAAACTATTCTTACGATTGTATCGTACTTGATATAATGC
TTCCTGTAATCGATGGACTCACAATATTGAAGAAACTTAGAAAGCAGAACAATACAACGCCTGTTATAATGCTTACGGCA
AAAGATACAGTAAAAGATAAAGTGTTAGGCTTAGATAGCGGTTCAGACGACTACTTAACTAAGCCATTTTCTTTTGAAGA
GTTATTGTCTCGCACTAAGGCTGTTATAAGACGCAAATATGAAATTTCAAGTCCTATTATAAAAGTTGATAATCTTGAGA
TTGACACGGCAAAAAAAACAGTAAAAAGAGCAAATCAGCCAATTGAGCTTTCCGCAAAAGAATATGCATTACTTGAGTAT
TTAGCTGCAAATAAAAACAAAGTTTTAAGCAGAACTATGATCATAGAGCATATATACAATGAAGAGTTTGATTTTGATAG
TAATGTAATAGATGTGTTTATAAACAGAATCAGAAACAAAATTGATAAAAACTTTGACAAAAAACTCGTTCATACAATTC
GTGGAATGGGATACGCTTTAAAAGAGTGA

Protein sequence :
MRILIVEDEKTLANLIKKGFEEEGFAVDIAYDGEDGLFFAQNYSYDCIVLDIMLPVIDGLTILKKLRKQNNTTPVIMLTA
KDTVKDKVLGLDSGSDDYLTKPFSFEELLSRTKAVIRRKYEISSPIIKVDNLEIDTAKKTVKRANQPIELSAKEYALLEY
LAANKNKVLSRTMIIEHIYNEEFDFDSNVIDVFINRIRNKIDKNFDKKLVHTIRGMGYALKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-41 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-43 47
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-40 46
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-32 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-41 45
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-25 44
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-41 44
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-39 43
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-38 43
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calni_0142 YP_004050219.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-41 43