Gene Information

Name : I653_06790 (I653_06790)
Accession : YP_007662122.1
Strain : subtilis subtilis BAB-1
Genome accession: NC_020832
Putative virulence/resistance : Virulence
Product : sensory transduction protein YkoG
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1355917 - 1356603 bp
Length : 687 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
TTGGAAAAAGGACACATATTAATTGTGGAAGATGAAGAAAAAATCGCCAGGGTTCTTCAGCTTGAATTGGAATATGAAGG
ATACAGTGTCACCATCAAACACAATGGCACAGAAGGTCTGGATGCGGCATTGGAAGGCGGGTATTCCTTGGTGCTTCTTG
ATGTCATGCTTCCGGGGCTTAGCGGACTGGAAGTGCTGCGCCGCTTGAGAAAAACGGATCCGCAGACACCGGTCATATTA
TTAACGGCGCGAGACAGTATTCCTGATAAGGTAACAGGTCTGGATATCGGTGCGAATGACTATGTCACCAAGCCGTTTGA
AATCGAGGAATTGCTTGCGAGAATCAGGGCGGCGCTGCGACAAAATGGAACAAAAACGGAAGATATCGGCACCTTTCTTA
CATATGACGATTTGCGGGTGAACGAAAAAAACCGTGAAGTGAGACGCGGAGACAAAGAGGTGGAATTAACGCCGCGGGAA
TTTGATTTACTCGTCTATATGCTAAAGCATCCGCAGCAAGTGCTGACACGGGAGCAAATTCTAAGCTCGGTATGGGGATT
TGATTATATCGGTGATACAAATGTCGTGGACGTCTACATAAGATACATCAGAAAAAAACTGGACTATCCTTACGAAAAAC
AGCTGATCCATACGATTCGCGGGGTCGGCTATGCCATTAAGGGGTAA

Protein sequence :
MEKGHILIVEDEEKIARVLQLELEYEGYSVTIKHNGTEGLDAALEGGYSLVLLDVMLPGLSGLEVLRRLRKTDPQTPVIL
LTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRAALRQNGTKTEDIGTFLTYDDLRVNEKNREVRRGDKEVELTPRE
FDLLVYMLKHPQQVLTREQILSSVWGFDYIGDTNVVDVYIRYIRKKLDYPYEKQLIHTIRGVGYAIKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-43 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-42 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_007793.3914065.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_007622.3794948.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_002951.3238224.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_002952.2859858.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_013450.8614146.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_010079.5776364.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_003923.1003417.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_002758.1121390.p0 Protein 9e-47 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG HE999704.1.gene1528. Protein 2e-45 48
I653_06790 YP_007662122.1 sensory transduction protein YkoG AE015929.1.gene1106. Protein 2e-41 46
I653_06790 YP_007662122.1 sensory transduction protein YkoG BAC0125 Protein 5e-44 46
I653_06790 YP_007662122.1 sensory transduction protein YkoG BAC0308 Protein 2e-43 45
I653_06790 YP_007662122.1 sensory transduction protein YkoG BAC0083 Protein 4e-45 44
I653_06790 YP_007662122.1 sensory transduction protein YkoG BAC0197 Protein 5e-41 44
I653_06790 YP_007662122.1 sensory transduction protein YkoG AE016830.1.gene1681. Protein 2e-41 43
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_012469.1.7686381. Protein 1e-41 42
I653_06790 YP_007662122.1 sensory transduction protein YkoG BAC0638 Protein 6e-38 42
I653_06790 YP_007662122.1 sensory transduction protein YkoG AF155139.2.orf0.gene Protein 1e-33 41
I653_06790 YP_007662122.1 sensory transduction protein YkoG FJ349556.1.orf0.gene Protein 1e-34 41
I653_06790 YP_007662122.1 sensory transduction protein YkoG NC_012469.1.7685629. Protein 1e-34 41
I653_06790 YP_007662122.1 sensory transduction protein YkoG BAC0111 Protein 3e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
I653_06790 YP_007662122.1 sensory transduction protein YkoG VFG0596 Protein 1e-43 46
I653_06790 YP_007662122.1 sensory transduction protein YkoG VFG1390 Protein 1e-48 44
I653_06790 YP_007662122.1 sensory transduction protein YkoG VFG1386 Protein 4e-48 44
I653_06790 YP_007662122.1 sensory transduction protein YkoG VFG1389 Protein 2e-41 42