Gene Information

Name : SSPA1358 (SSPA1358)
Accession : YP_002142197.1
Strain : Salmonella enterica AKU12601
Genome accession: NC_011147
Putative virulence/resistance : Virulence
Product : pathogenicity island secreted effector protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1527078 - 1527479 bp
Length : 402 bp
Strand : -
Note : similar to Salmonella typhi Ty2 pathogenicity island secreted effector protein

DNA sequence : 
ATGTCTGAGGAGGGATTCATGCTGGCAGTTTTAAAAGGCATTCCATTAATTCAGGATATCAAGGCCGAAGGTAATAGCCG
ATCCTGGATAATGACTATTGATGGGCATCCTGCCAGAGGAGAAATTTTCTCAGAAGCATTTTCTATTTCTTTGTTCTTAA
ATGACCTGGAAAGCTTACCTAAGCCTTGTCTTGCCTATGTGACACTACTGCTTGCAGCACACCCGGACGTCCATGATTAT
GCTATACAGCTCACAGCGGATGGGGGATGGTTAAACGGTTATTATACCACAAGTAGTAGCTCTGAGCTTATTGCTATTGA
GATAGAAAAACACCTGGCTTTAACTTGCATTTTAAAAAATGTAATACGCAATCACCATAAACTTTATTCGGGTGGGGTAT
AA

Protein sequence : 
MSEEGFMLAVLKGIPLIQDIKAEGNSRSWIMTIDGHPARGEIFSEAFSISLFLNDLESLPKPCLAYVTLLLAAHPDVHDY
AIQLTADGGWLNGYYTTSSSSELIAIEIEKHLALTCILKNVIRNHHKLYSGGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spiC AEZ06295.1 pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 1e-49 100
spiC AEZ06296.1 pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 1e-49 100
spiC AEZ06297.1 pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 2e-49 99
spiC AEZ06300.1 pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 2e-49 99
spiC AEZ06298.1 pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 2e-49 99
spiC AEZ06299.1 pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 1e-49 99
spiC NP_456135.1 putative pathogenicity island 2 secreted effector protein Virulence SPI-2 Protein 2e-49 99
spiC NP_805064.1 pathogenicity island secreted effector protein Virulence SPI-2 Protein 2e-49 99
spiC AAC44300.1 SpiC Virulence SPI-2 Protein 1e-52 99
ssaB YP_216401.1 secretion system apparatus protein SsaB Virulence SPI-2 Protein 2e-52 99
ssaB NP_460358.1 secreted effector protein Virulence SPI-2 Protein 2e-52 99

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSPA1358 YP_002142197.1 pathogenicity island secreted effector protein VFG0494 Protein 5e-53 99