Gene Information

Name : BCAM1418 (BCAM1418)
Accession : YP_002234033.1
Strain :
Genome accession: NC_011001
Putative virulence/resistance : Virulence
Product : two-component regulatory system response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1575817 - 1576512 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
ATGAAAGTGCTGATCGTCGAAGACGAACCGAAAGTCGTCGAATACCTGAAGAGCGGCCTGACCGAGGAAGGCTGGGTCGT
CGACACCGCGCTCGACGGCGAGGACGGTGCGTGGAAAGCCGTCGAATTCGACTACGACGTGGTCGTGCTCGACGTGATGC
TGCCGAAGCTCGACGGCTTCGGCGTGCTGCGTGCGTTGCGCGCGCAGAAGCAGACGCCCGTCATCATGCTGACCGCGCGC
GATCGCGTCGACGACCGCGTGCGCGGCTTGCGCGGCGGCGCCGACGACTACCTGACCAAGCCGTTCTCGTTCCTCGAGCT
GATCGAACGGCTGCGCGCGCTGACGCGCCGCGCCCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGACCTGCGCGTCG
ACCTGATCGGCCGCCGCGCGACCCGCGACGGCACGCGGCTCGACCTCACCGCGCAGGAATTCCAGCTGCTCGGCGTGCTC
GCGCGGCGCAGCGGCGAGGTGCTGTCGAAGACGACCATCGCCGAACTCGTGTGGGACGTGAACTTCGACAGCAATGCGAA
CGTCGTCGAAACGGCGATCAAGCGCCTGCGCGCGAAGCTCGACGGCCCGTTCGCGGACAAGCTGCTGCACACGATCCGCG
GGATGGGCTACGTGCTCGAAGCGCGCGAGGACGGCGACGCGGAGCGGCGCGCATGA

Protein sequence :
MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDYDVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVL
ARRSGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFADKLLHTIRGMGYVLEAREDGDAERRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-41 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-40 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0083 Protein 3e-48 58
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0125 Protein 1e-52 58
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0197 Protein 2e-47 54
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0638 Protein 4e-39 54
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0111 Protein 3e-45 51
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0308 Protein 2e-45 51
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein BAC0347 Protein 1e-40 48
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein CP001918.1.gene5135. Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein VFG0596 Protein 1e-41 52
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein VFG1389 Protein 5e-31 48
BCAM1418 YP_002234033.1 two-component regulatory system response regulator protein VFG1386 Protein 3e-26 42