Gene Information

Name : PA1437 (PA1437)
Accession : NP_250128.1
Strain : Pseudomonas aeruginosa PAO1
Genome accession: NC_002516
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1567181 - 1567870 bp
Length : 690 bp
Strand : +
Note : Product name confidence: class 3 (Function proposed based on presence of conserved amino acid motif, structural feature or limited sequence similarity to an experimentally studied gene)

DNA sequence :
ATGCGGGTACTGATTGTCGAGGACGAGGCGAAGACGGCGGACTACCTGAACCGTGGCCTCAGCGAACAGGGGTTCACCGT
GGACCTGGCGGACAACGGCATCGACGGTCGCCACCTGGCGCTCCATGGCGAGTACGACGTGATCGTGCTCGACGTGATGC
TGCCGGGCGTCGACGGCTACGGCGTTCTGCGGGCGTTGCGCGAGCGGCGGCAGACCCCGGTGATCATGCTCACCGCGCGC
GAGCGCGTGGAAGACCGGGTGCGCGGGCTGCGCGAGGGCGCCGACGACTACCTGATCAAGCCGTTCTCCTTCCTCGAACT
GGTCGCCCGCCTGCAGGCCCTGACCCGGCGCGGCGGCAACCACGAAAGCCATTCGCAGATGCGCATCGCCGACCTGTCCA
TCGACCTGCTCAGCCGCAAGGTCTTCCGTGGCAACACCCGTCTGGAGCTGACTGCCAAGGAGTACGCGCTGCTCTGCGTG
CTGGCCCAGCGCAGCGGCGAGATCCTGTCGAAGACGGCGATCGCCGAACTGGTCTGGGACATCAACTTCGATACCGACAC
CAATGTCGTGGAGGTGGCGATCAAGCGCCTGCGCGCCAAGCTCGACGGTCCGTTCGAGAACAAGCTGCTGCATACCATCC
GGGGCATGGGCTACGTCCTGGAGAACCGTGCGCTGGCGGAGTCGGGCTGA

Protein sequence :
MRVLIVEDEAKTADYLNRGLSEQGFTVDLADNGIDGRHLALHGEYDVIVLDVMLPGVDGYGVLRALRERRQTPVIMLTAR
ERVEDRVRGLREGADDYLIKPFSFLELVARLQALTRRGGNHESHSQMRIADLSIDLLSRKVFRGNTRLELTAKEYALLCV
LAQRSGEILSKTAIAELVWDINFDTDTNVVEVAIKRLRAKLDGPFENKLLHTIRGMGYVLENRALAESG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-54 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-53 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PA1437 NP_250128.1 two-component response regulator BAC0125 Protein 2e-65 61
PA1437 NP_250128.1 two-component response regulator BAC0638 Protein 3e-55 57
PA1437 NP_250128.1 two-component response regulator BAC0197 Protein 3e-59 56
PA1437 NP_250128.1 two-component response regulator BAC0083 Protein 1e-58 56
PA1437 NP_250128.1 two-component response regulator BAC0111 Protein 1e-60 55
PA1437 NP_250128.1 two-component response regulator BAC0308 Protein 1e-55 54
PA1437 NP_250128.1 two-component response regulator BAC0347 Protein 4e-55 52
PA1437 NP_250128.1 two-component response regulator AE015929.1.gene1106. Protein 4e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PA1437 NP_250128.1 two-component response regulator VFG0596 Protein 2e-54 54
PA1437 NP_250128.1 two-component response regulator VFG1389 Protein 2e-36 44
PA1437 NP_250128.1 two-component response regulator VFG1390 Protein 2e-38 43
PA1437 NP_250128.1 two-component response regulator VFG1386 Protein 2e-35 42