Gene Information

Name : AM1_1480 (AM1_1480)
Accession : YP_001515822.1
Strain : Acaryochloris marina MBIC11017
Genome accession: NC_009925
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1469950 - 1470624 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGACAGCACATATTCTCCTGGTTGAAGACGAAACCAAACTGGCTCAATTTGTTGAAATGGAACTGACCCATGAGGGGTA
TCAGGTGACCGTGGCCAATGATGGCATCGGGGGACTCACCGCTGCTCGCGAGTCTCAACCGGATTTAATTCTCCTGGACT
GGATGCTGCCAGGATTCTCTGGCGTTGAAGTCTGTCGACGTCTGCGGGCAACCGGGGATAAAGTTCCCGTTATTTTATTG
ACCGCCAAAGATGAAATTAGCGATCGGGTCGAAGGGCTAGATGCCGGGGCGGATGACTATATGGTGAAGCCCTTTAGCAT
CGAAGAGCTGTTAGCTAGGGTGCGAGCCCACTTGCGGCGCACCCAGGAAGAAGATCCCGATGTCCTAGAATTCTCCAACT
TGACCCTTAACCAGCGCACCCGTGAGATCTTCCGCGGTGAACGCTCGATTGAGCTAACGGCCAAGGAGTTTGATTTGCTG
GTGTATTTGATGATGCATCCTCGCCAGGTATTGACCCGCGATCGCATCCTGGAACAAGTCTGGGGCTACGACTTTATGGG
AGACTCCAATATCATCGAAGTTTACATTCGCTACCTTCGTCTCAAGCTAGAAGAGAACCAAGAAAAGCGGTTAATTCAGA
CGGTCAGGGGCGTGGGTTATGTCATGAGAGAGTAA

Protein sequence :
MTAHILLVEDETKLAQFVEMELTHEGYQVTVANDGIGGLTAARESQPDLILLDWMLPGFSGVEVCRRLRATGDKVPVILL
TAKDEISDRVEGLDAGADDYMVKPFSIEELLARVRAHLRRTQEEDPDVLEFSNLTLNQRTREIFRGERSIELTAKEFDLL
VYLMMHPRQVLTRDRILEQVWGYDFMGDSNIIEVYIRYLRLKLEENQEKRLIQTVRGVGYVMRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-36 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-35 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AM1_1480 YP_001515822.1 two-component transcriptional regulator HE999704.1.gene1528. Protein 2e-47 51
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_007793.3914065.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002758.1121390.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_010079.5776364.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002952.2859858.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_007622.3794948.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_003923.1003417.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_013450.8614146.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002951.3238224.p0 Protein 8e-49 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator AE015929.1.gene1106. Protein 2e-45 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator AE000516.2.gene3505. Protein 5e-43 48
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0197 Protein 1e-39 46
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002952.2859905.p0 Protein 1e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0083 Protein 1e-40 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_013450.8614421.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_007793.3914279.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002745.1124361.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_009782.5559369.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002951.3237708.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_003923.1003749.p0 Protein 1e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002758.1121668.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_007622.3794472.p0 Protein 1e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_009641.5332272.p0 Protein 2e-43 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0125 Protein 4e-43 44
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0308 Protein 7e-42 44
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_012469.1.7686381. Protein 7e-45 43
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0111 Protein 6e-40 43
AM1_1480 YP_001515822.1 two-component transcriptional regulator CP000034.1.gene3671. Protein 2e-36 43
AM1_1480 YP_001515822.1 two-component transcriptional regulator CP001485.1.gene721.p Protein 2e-31 42
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0347 Protein 8e-38 42
AM1_1480 YP_001515822.1 two-component transcriptional regulator AF155139.2.orf0.gene Protein 2e-35 42
AM1_1480 YP_001515822.1 two-component transcriptional regulator BAC0638 Protein 4e-35 42
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_012469.1.7685629. Protein 3e-37 41
AM1_1480 YP_001515822.1 two-component transcriptional regulator NC_002516.2.879194.p Protein 1e-29 41
AM1_1480 YP_001515822.1 two-component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-36 41
AM1_1480 YP_001515822.1 two-component transcriptional regulator AE016830.1.gene1681. Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AM1_1480 YP_001515822.1 two-component transcriptional regulator VFG1390 Protein 2e-56 54
AM1_1480 YP_001515822.1 two-component transcriptional regulator VFG0596 Protein 9e-37 46
AM1_1480 YP_001515822.1 two-component transcriptional regulator VFG1389 Protein 1e-42 45
AM1_1480 YP_001515822.1 two-component transcriptional regulator VFG1386 Protein 3e-48 43