Gene Information

Name : Amet_1506 (Amet_1506)
Accession : YP_001319359.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1566498 - 1567181 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: dsy:DSY1143 hypothetical protein

DNA sequence :
ATGAGCGGAAAAAAGATTCTTATTATTGAGGATGAGGTAAAAATAGCCAGGTTTCTGGAGCTAGAGCTAATGCATGAGGG
GTACCAGGTAGCACAAGCCCATGATGGTAGGAAGGGTCTTGAGATGGCGGAGCGGGAGACCTTTGATTTGATTATTCTCG
ACATCATGCTTCCATATATGAATGGGATAGAGGTGTTGAGAAAGATTAGACATAACTCAGAGGTTCCTATTATTATGCTG
ACTGCCAAGGATGAAGTGATGGACAAGGTCATAGGTCTAGATATGGGGGCTAATGATTACATAACAAAGCCCTTTGCCAT
AGAGGAGCTTTTAGCCAGGATCAGATCAGCCTTGAAGACAAAAAACCATGGCATTTCAGAAGGCAGGTCTTTACAGAGTG
GGAGTTTGAAGCTTGACATTGATAAACATAAGGTTACCTATGATGAAGAAACCGTTGAGCTTACAAAGAAGGAATTTGAT
TTATTACACTATTTTTTAGAAAACCATGACATTGTACTCACTAGGGATAAAATTCTTCAGACCGTCTGGGGTTATGACTA
CATGGGAGATACCAATATAGTTGATGTGTATATTAGATACTTGAGAAGTAAGATAGATGATAAATATAACAAAAAGATTA
TTTATACAATCAGAGGGGTGGGATATCTTTTAAAAAATGAGTAA

Protein sequence :
MSGKKILIIEDEVKIARFLELELMHEGYQVAQAHDGRKGLEMAERETFDLIILDIMLPYMNGIEVLRKIRHNSEVPIIML
TAKDEVMDKVIGLDMGANDYITKPFAIEELLARIRSALKTKNHGISEGRSLQSGSLKLDIDKHKVTYDEETVELTKKEFD
LLHYFLENHDIVLTRDKILQTVWGYDYMGDTNIVDVYIRYLRSKIDDKYNKKIIYTIRGVGYLLKNE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-36 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_1506 YP_001319359.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-45 52
Amet_1506 YP_001319359.1 two component transcriptional regulator AE015929.1.gene1106. Protein 7e-42 51
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-45 50
Amet_1506 YP_001319359.1 two component transcriptional regulator BAC0125 Protein 9e-39 45
Amet_1506 YP_001319359.1 two component transcriptional regulator BAC0197 Protein 1e-36 45
Amet_1506 YP_001319359.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-40 45
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-38 44
Amet_1506 YP_001319359.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-31 44
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-36 43
Amet_1506 YP_001319359.1 two component transcriptional regulator BAC0111 Protein 1e-35 43
Amet_1506 YP_001319359.1 two component transcriptional regulator BAC0308 Protein 1e-36 42
Amet_1506 YP_001319359.1 two component transcriptional regulator BAC0083 Protein 2e-37 41
Amet_1506 YP_001319359.1 two component transcriptional regulator BAC0347 Protein 6e-35 41
Amet_1506 YP_001319359.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-30 41
Amet_1506 YP_001319359.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_1506 YP_001319359.1 two component transcriptional regulator VFG0596 Protein 3e-36 44
Amet_1506 YP_001319359.1 two component transcriptional regulator VFG1390 Protein 4e-40 41