Gene Information

Name : PP1Y_AT16532 (PP1Y_AT16532)
Accession : YP_004534348.1
Strain : Novosphingobium sp. PP1Y
Genome accession: NC_015580
Putative virulence/resistance : Virulence
Product : two-component system OmpR family response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1742561 - 1743235 bp
Length : 675 bp
Strand : +
Note : assigned by KAAS to KEGG Orthology:K02483 two-component system, OmpR family, response regulator

DNA sequence :
ATGCGCATCCTGATTGCAGAGGATGACGGCGAAACCGCCGGGTTCGTCGAGCGAGGGCTCGGCGAACTCGGCCATAATGT
CGTGGTCGCGGGCAATGGCGAGGATGCGCTCCACCTAGGTCTGACCGAGGATTTCGACTTGCTGATCCTCGACCGGATGA
TGCCGGGTCTCGACGGGCTCTCGGTGCTCAAGCGCCTCCGCGCCGCCGACATCGCCGTGCCCGCGCTGATGCTCACCGCG
CTGGGGCGGATCGAGGATCGCGTCGCCGGGCTCGATACCGGCGCCGACGATTATCTGGTCAAGCCGTTCGCATTCAGCGA
GCTGGCCGCGCGCGTCCATGCGCTCGGCCGCCGTCGCGCGCCGCAGGTTGCCGAAACCCGGCTGCGGGCGGGAACGGTCG
AAATGGACCTGCTGGCGCGCGAAGTGCGACGCGACGGAGAACTCGTCACGCTCCAGCCCAAGGAATTTCGCCTGCTCGAG
GAACTGATGCGCCACGCCGGCGAATATGTGACGCGCACCATGCTGCTCGAACGCGTGTGGGACTTTCATTGCGACCCGCA
GACCAAGATCGTCGAAACGCACATCAGCCGATTGCGCTCGAAGCTCAACGAAGGCGGCCGTGCCGACGTGATCGAAACCG
AACGCGGCGTGGGCTATCGGATACGCGCGGGATGA

Protein sequence :
MRILIAEDDGETAGFVERGLGELGHNVVVAGNGEDALHLGLTEDFDLLILDRMMPGLDGLSVLKRLRAADIAVPALMLTA
LGRIEDRVAGLDTGADDYLVKPFAFSELAARVHALGRRRAPQVAETRLRAGTVEMDLLAREVRRDGELVTLQPKEFRLLE
ELMRHAGEYVTRTMLLERVWDFHCDPQTKIVETHISRLRSKLNEGGRADVIETERGVGYRIRAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-39 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-38 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0638 Protein 1e-41 48
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0083 Protein 1e-44 47
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0197 Protein 2e-40 46
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0111 Protein 6e-48 45
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0347 Protein 1e-43 44
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0125 Protein 5e-41 44
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator U82965.2.orf14.gene. Protein 1e-29 42
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator AE000516.2.gene3505. Protein 6e-28 42
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator BAC0533 Protein 6e-15 41
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator CP000647.1.gene4257. Protein 6e-15 41
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator CP001918.1.gene5135. Protein 8e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator VFG0596 Protein 2e-39 46
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator VFG1389 Protein 5e-33 43
PP1Y_AT16532 YP_004534348.1 two-component system OmpR family response regulator VFG1390 Protein 1e-32 41