Gene Information

Name : BPTD_0155 (BPTD_0155)
Accession : YP_005588433.1
Strain : Bordetella pertussis CS
Genome accession: NC_017223
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 157030 - 157707 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGTGCATCCTCGTTATCGAAGACGAGCCCAAGCTGGCCGACTATCTGCACAAGGGCCTGTCCGAGCAAAGCCATATCGT
CGACGTCGCGCGCGACGGCGTCAACGGCCGCCACCTGGCGCTCGAGGGCGACTACGAACTGGTCATCCTCGACGTGATGC
TGCCCGACATCGACGGCTTCGCCGTCCTGGCGGCGCTGCGCGCGGCCGCGCGCAACACGCCGGTGCTGATGCTGACGGCG
CGCGACCGGGTCGAGGACCGCGTGCGCGGGCTGGAAGGCGGCGCCGACGACTACCTGGTCAAGCCGTTCGCGTTCTCCGA
GCTCCTGGCGCGCGTGCATGCGCTGCAGCGGCGCGGGCGCAGCCAGGAATCCACCCTGCTGCGCCTGGCCGACCTCGAGC
TGGACCTGGCCAGCCGCAAGGCGCAGCGCGGCGGACGCCGCCTGGACCTGACGGCCAAGGAGTTTTCGCTGCTGGCGCTG
CTGCTGCGCCGCCAGGGCCAGATCCTGTCGCGCACCACGCTGGCCGAGCAGGTCTGGGACATGAACTTCGACAGCGACAC
CAACGTCATCGACGTCGCCATCCGCCGGCTGCGCGGCAAGCTGGACGACCCCTACGACGCCAAGCTGCTGCATACCGTGC
GCGGCATGGGCTACGTGCTGGAATCGCGCCCGTCATGA

Protein sequence :
MCILVIEDEPKLADYLHKGLSEQSHIVDVARDGVNGRHLALEGDYELVILDVMLPDIDGFAVLAALRAAARNTPVLMLTA
RDRVEDRVRGLEGGADDYLVKPFAFSELLARVHALQRRGRSQESTLLRLADLELDLASRKAQRGGRRLDLTAKEFSLLAL
LLRRQGQILSRTTLAEQVWDMNFDSDTNVIDVAIRRLRGKLDDPYDAKLLHTVRGMGYVLESRPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-46 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-46 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BPTD_0155 YP_005588433.1 two-component response regulator BAC0197 Protein 1e-53 64
BPTD_0155 YP_005588433.1 two-component response regulator BAC0125 Protein 2e-54 61
BPTD_0155 YP_005588433.1 two-component response regulator BAC0083 Protein 1e-53 61
BPTD_0155 YP_005588433.1 two-component response regulator BAC0638 Protein 1e-46 59
BPTD_0155 YP_005588433.1 two-component response regulator BAC0111 Protein 4e-55 57
BPTD_0155 YP_005588433.1 two-component response regulator BAC0308 Protein 9e-51 54
BPTD_0155 YP_005588433.1 two-component response regulator BAC0347 Protein 2e-47 50
BPTD_0155 YP_005588433.1 two-component response regulator AE000516.2.gene3505. Protein 3e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BPTD_0155 YP_005588433.1 two-component response regulator VFG0596 Protein 6e-47 55
BPTD_0155 YP_005588433.1 two-component response regulator VFG1389 Protein 5e-29 44
BPTD_0155 YP_005588433.1 two-component response regulator VFG1390 Protein 5e-34 41