Gene Information

Name : ykoG (GYO_1648)
Accession : YP_004876926.1
Strain : Bacillus subtilis TU-B-10
Genome accession: NC_016047
Putative virulence/resistance : Virulence
Product : response regulator YkoG
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1500548 - 1501234 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
TTGGAAAAAGGGCACATATTAATTGTGGAAGATGAAGAGAAAATTGCCAGGGTGCTCCAGCTTGAATTGGAATATGAAGG
ATATAGCGTCACTATTAAACACGATGGCACAGAAGGACTGAATGCGGCCGCGGAAGGCGGGTATTCCTTAGTGCTTCTTG
ATGTCATGCTTCCGGGACTTAGCGGCCTGGAAGTGCTGCGCCGCTTGAGAAAAACGGATCAGCAGACACCGGTCATTTTA
TTAACGGCACGCGACAGTATCCCTGATAAGGTAACAGGGCTGGACATCGGTGCGAATGATTATGTCACCAAGCCGTTTGA
AATCGAGGAATTGCTTGCGAGAATCAGGGCGGCGCTGCGCCAAAATGGAACAAAAACAGAAGATATCGGCACCTTTCTTA
CATATGACGACTTGCGGGTGAACGAAAAAACCCGTGAAGTGAGACGCGGAGACAAAGAGGTGGAATTAACGCCCCGGGAA
TTTGATTTGCTCGTGTATATGCTGAAGCATCCGCAGCAAGTGCTGACACGGGAGCAGATTCTAAACTCGGTATGGGGATT
TGATTATATCGGTGATACAAATGTCGTGGACGTCTACATCAGATACATTAGAAAAAAACTGGACTATCCTTACGAAAAAC
AGCTGATACATACCGTTCGCGGGGTCGGCTATGCCATTAAGGGGTAA

Protein sequence :
MEKGHILIVEDEEKIARVLQLELEYEGYSVTIKHDGTEGLNAAAEGGYSLVLLDVMLPGLSGLEVLRRLRKTDQQTPVIL
LTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRAALRQNGTKTEDIGTFLTYDDLRVNEKTREVRRGDKEVELTPRE
FDLLVYMLKHPQQVLTREQILNSVWGFDYIGDTNVVDVYIRYIRKKLDYPYEKQLIHTVRGVGYAIKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-43 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-42 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_004876926.1 response regulator YkoG NC_007793.3914065.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_007622.3794948.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_002951.3238224.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_002952.2859858.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_013450.8614146.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_010079.5776364.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_003923.1003417.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG NC_002758.1121390.p0 Protein 1e-46 48
ykoG YP_004876926.1 response regulator YkoG HE999704.1.gene1528. Protein 8e-45 48
ykoG YP_004876926.1 response regulator YkoG AE015929.1.gene1106. Protein 6e-41 46
ykoG YP_004876926.1 response regulator YkoG BAC0125 Protein 2e-44 45
ykoG YP_004876926.1 response regulator YkoG BAC0308 Protein 4e-44 44
ykoG YP_004876926.1 response regulator YkoG BAC0197 Protein 7e-42 44
ykoG YP_004876926.1 response regulator YkoG BAC0083 Protein 2e-44 43
ykoG YP_004876926.1 response regulator YkoG AE016830.1.gene1681. Protein 8e-41 43
ykoG YP_004876926.1 response regulator YkoG FJ349556.1.orf0.gene Protein 2e-35 42
ykoG YP_004876926.1 response regulator YkoG AF155139.2.orf0.gene Protein 2e-34 41
ykoG YP_004876926.1 response regulator YkoG NC_012469.1.7686381. Protein 4e-42 41
ykoG YP_004876926.1 response regulator YkoG BAC0111 Protein 3e-41 41
ykoG YP_004876926.1 response regulator YkoG BAC0638 Protein 4e-37 41
ykoG YP_004876926.1 response regulator YkoG NC_002952.2859905.p0 Protein 3e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_007622.3794472.p0 Protein 3e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_007793.3914279.p0 Protein 4e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_002951.3237708.p0 Protein 4e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_013450.8614421.p0 Protein 4e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_009782.5559369.p0 Protein 4e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_009641.5332272.p0 Protein 4e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_002745.1124361.p0 Protein 4e-39 41
ykoG YP_004876926.1 response regulator YkoG NC_002758.1121668.p0 Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_004876926.1 response regulator YkoG VFG0596 Protein 2e-43 46
ykoG YP_004876926.1 response regulator YkoG VFG1390 Protein 5e-50 46
ykoG YP_004876926.1 response regulator YkoG VFG1386 Protein 1e-48 44
ykoG YP_004876926.1 response regulator YkoG VFG1389 Protein 1e-42 43