Gene Information

Name : Tsac_1621 (Tsac_1621)
Accession : YP_006392226.1
Strain : Thermoanaerobacterium saccharolyticum JW/SL-YS485
Genome accession: NC_017992
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1697454 - 1698140 bp
Length : 687 bp
Strand : +
Note : KEGG: txy:Thexy_1114 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver r

DNA sequence :
ATGGAAGAAAGCATACTCATAATTGAAGATGAGAAAAGAATTGCGAGATTTTTACAGATAGAGCTTGAACATGAAGGTTA
TAGTGTGACATTAGAATATAGCGGCAATAGTGGTTTAAGAAAGGCTTTAGATGGAGATTACGATTTGATAATCTTAGATT
TGATGCTTCCAGGTTTGGATGGTTTTTCAGTCTTGAGAGAACTGAGAAAAAAATCATCAACACCTGTAATAATTTTAAGC
GCAAAAGATGAGGTAAAAGACAAGGTATTAGGGCTTGATATAGGCGCTGATGATTATCTTACGAAGCCGTTTTCGATTGA
AGAGCTTATGGCGAGAATAAGAAATGCCCTTAGAAAAAATGCAAAGTCAAATGCTAATAAATTGGCATATGATGGCATAA
CAATGGACCTGTCTACATACGAAGTAAAAAGAGATGGAATAAAGGTAGAGTTGACGAAAAAAGAGTTTGAGCTTTTGAAA
TATTTGATTATAAACTCTGAAATAGTGCTTACAAGAGAAAATATATTGGAGAATGTATGGGGCTACAATTATATTGGTGA
GACAAACATAGTTGATGTGTACATAAGATATTTGAGGAGTAAAATTGATGAACCGTTTAATAATAAGTTGATACAGACGG
TAAGAGGTGTAGGATACTCTTTAAGGAAAGAAAAAGATGAAGATTAA

Protein sequence :
MEESILIIEDEKRIARFLQIELEHEGYSVTLEYSGNSGLRKALDGDYDLIILDLMLPGLDGFSVLRELRKKSSTPVIILS
AKDEVKDKVLGLDIGADDYLTKPFSIEELMARIRNALRKNAKSNANKLAYDGITMDLSTYEVKRDGIKVELTKKEFELLK
YLIINSEIVLTRENILENVWGYNYIGETNIVDVYIRYLRSKIDEPFNNKLIQTVRGVGYSLRKEKDED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-42 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-41 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-41 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-46 54
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-39 49
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-37 48
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-44 47
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-38 46
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-33 44
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-28 44
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-35 43
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-28 43
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-34 43
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-32 43
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-37 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-32 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-36 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-27 41
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-28 41
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator BAC0347 Protein 6e-31 41
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-42 47
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-41 43
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-44 42
Tsac_1621 YP_006392226.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-39 41